| adventcalendar.overrideadventcalendarday | конвар | 0 | |
| adventcalendar.overrideadventcalendarmonth | конвар | 0 | |
| ai.accuratevisiondistance | конвар | True | When enabled, vision distance checks use per-bone raycasts for accuracy; disable to use a single origin ray for performance |
| ai.addignoreplayer | команда | — | Add a player (or command user if no player is specified) to the AIs ignore list. |
| ai.aimedatangle | конвар | 10 | The angle under which the AI will think it's being aimed at at by a player |
| ai.aizonestats | команда | — | Prints the total count of registered AIInformationZone instances on the server |
| ai.animal_ignore_food | конвар | True | If animal_ignore_food is true, animals will not sense food sources or interact with them (server optimization). (default: true) |
| ai.batch_navmesh_pathfollowing | конвар | True | Run RustNav movement, steering and corridor queries in the transform job. |
| ai.batch_navmesh_transforms | конвар | True | Batch RustNav agent transform updates using jobs. Disable to apply each update immediately. |
| ai.brainstats | команда | — | Prints the current count of active animal, scientist, pet, and new NPC2 brain instances on the server |
| ai.clearignoredplayers | команда | — | Remove all players from the AIs ignore list. |
| ai.critters_frametime | конвар | 0.2 | Target frame time in seconds for the Critters budget |
| ai.critters_startle_distance | конвар | 0.5 | How close can a player get before a critter gets startled and runs away |
| ai.debugmovedraw | конвар | True | Whether ai.selectnpc and ai.movenpc draw their DDraw markers - turn it off to keep the view clean while commanding NPCs. |
| ai.debugmovegait | конвар | run | Gait ai.movenpc uses when called without one - set it to walk to keep commanded NPCs at walking speed. One of: sneak, walk, jog, run, sprint, fullsprint |
| ai.debugmovespacing | конвар | 2 | Gap in metres between the destinations ai.movenpc hands out when more than one NPC is selected, so they don't all path to the same point. |
| ai.defaultinterpolationdelay | конвар | 0.1 | Default network interpolation delay in seconds applied to NPC entity movement; lower values reduce visual lag at the cost of jitter on unstable connections |
| ai.deselectnpc | команда | — | Removes the NPC you are looking at from your selection and hands it back to its normal AI. |
| ai.designingenabled | конвар | False | |
| ai.effectaiweapons | конвар | False | When enabled, AI weapons deal real damage when fired; disable to make NPC weapons harmless for testing AI behaviour safely |
| ai.frametime | конвар | 5 | Target frame time budget in seconds for AI tick processing; default is 5s in production (1s in editor) to cap CPU usage per AI frame |
| ai.fsm_frametime | конвар | 1 | Target frame time in seconds for the default FSMComponent budget |
| ai.groups | конвар | True | When enabled, AI group logic is active allowing NPCs to coordinate as squads; disable to make all NPCs act as independent individuals |
| ai.ignoreplayers | конвар | False | When enabled, AI entities ignore player presence and will not target or react to players; useful for building/testing without NPC interference |
| ai.killanimals | команда | — | Kills all animal NPCs and animal NPC2 entities currently on the server |
| ai.killscientists | команда | — | Kills all scientist NPCs, tunnel dwellers, and non-animal NPC2 entities currently on the server |
| ai.logissues | конвар | False | When enabled, logs AI-related warnings and issues to the server console; useful for diagnosing pathfinding and brain errors |
| ai.move | конвар | True | When enabled, AI entities move toward their NavMesh destinations; disable to freeze NPC movement while keeping brain logic running |
| ai.movenpc | команда | — | Orders every NPC selected with ai.selectnpc to path to the position you are looking at. Optional gait: sneak, walk, jog, run, sprint, fullsprint - defaults to ai.debugmovegait. |
| ai.nav_carve_height | конвар | 2 | The height of the carve volume. (default: 2) |
| ai.nav_carve_min_base_size | конвар | 2 | The minimum size we allow a carving volume to be. (default: 2) |
| ai.nav_carve_min_building_blocks_to_apply_optimization | конвар | 25 | The minimum number of building blocks a building needs to consist of for this optimization to be applied. (default: 25) |
| ai.nav_carve_size_multiplier | конвар | 4 | The size multiplier applied to the size of the carve volume. The smaller the value, the tighter the skirt around foundation edges, but too small and animals can attack through walls. (default: 4) |
| ai.nav_carve_use_building_optimization | конвар | False | If nav_carve_use_building_optimization is true, we attempt to reduce the amount of navmesh carves for a building. (default: false) |
| ai.navthink | конвар | True | When enabled, AI entities update their NavMesh agent destinations each tick; disable to freeze AI movement while keeping brain logic running |
| ai.npc_alertness_drain_rate | конвар | 0.01 | npc_alertness_drain_rate define the rate at which we drain the alertness level of an NPC when there are no enemies in sight. (Default: 0.01) |
| ai.npc_alertness_to_aim_modifier | конвар | 0.5 | This is multiplied with the current alertness (0-10) to decide how long it will take for the NPC to deliberately miss again. (default: 0.33) |
| ai.npc_alertness_zero_detection_mod | конвар | 0.5 | npc_alertness_zero_detection_mod define the threshold of visibility required to detect an enemy when alertness is zero. (Default: 0.5) |
| ai.npc_check_spawner_is_on_navmesh | конвар | True | When enabled, NPC spawn points are validated to ensure they are on a valid NavMesh position before spawning; prevents NPCs from spawning in unreachable locations |
| ai.npc_cover_compromised_cooldown | конвар | 10 | npc_cover_compromised_cooldown defines how long a cover point is marked as compromised before it's cleared again for selection. (default: 10) |
| ai.npc_cover_info_tick_rate_multiplier | конвар | 20 | The rate at which we gather information about available cover points. Minimum value is 1, as it multiplies with the tick-rate of the fixed AI tick rate of 0.1 (Default: 20) |
| ai.npc_cover_path_vs_straight_dist_max_diff | конвар | 2 | npc_cover_path_vs_straight_dist_max_diff defines what the maximum difference between straight-line distance and path distance can be when evaluating cover points. (default: 2) |
| ai.npc_cover_use_path_distance | конвар | True | If npc_cover_use_path_distance is set to true then npcs will look at the distance between the cover point and their target using the path between the two, rather than the straight-line distance. |
| ai.npc_deliberate_hit_randomizer | конвар | 0.85 | The percentage away from a maximum miss the randomizer is allowed to travel when shooting to deliberately hit the target (we don't want perfect hits with every shot). (default: 0.85f) |
| ai.npc_deliberate_miss_offset_multiplier | конвар | 1.25 | The offset with which the NPC will maximum miss the target. (default: 1.25) |
| ai.npc_deliberate_miss_to_hit_alignment_time | конвар | 1.5 | The time it takes for the NPC to deliberately miss to the time the NPC tries to hit its target. (default: 1.5) |
| ai.npc_door_trigger_size | конвар | 1.5 | npc_door_trigger_size defines the size of the trigger box on doors that opens the door as npcs walk close to it (default: 1.5) |
| ai.npc_enable | конвар | True | If npc_enable is set to false then npcs won't spawn. (default: true) |
| ai.npc_families_no_hurt | конвар | True | If npc_families_no_hurt is true, npcs of the same family won't be able to hurt each other. (default: true) |
| ai.npc_gun_noise_silencer_modifier | конвар | 0.15 | The modifier by which a silencer reduce the noise that a gun makes when shot. (Default: 0.15) |
| ai.npc_htn_player_base_damage_modifier | конвар | 1.15 | Baseline damage modifier for the new HTN Player NPCs to nerf their damage compared to the old NPCs. (default: 1.15f) |
| ai.npc_htn_player_frustration_threshold | конвар | 3 | npc_htn_player_frustration_threshold defines where the frustration threshold for NPCs go, where they have the opportunity to change to a more aggressive tactic. (default: 3) |
| ai.npc_ignore_chairs | конвар | True | If npc_ignore_chairs is true, npcs won't care about seeking out and sitting in chairs. (default: true) |
| ai.npc_junkpile_dist_aggro_gate | конвар | 8 | npc_junkpile_dist_aggro_gate define at what range (or closer) a junkpile scientist will get aggressive. (Default: 8) |
| ai.npc_junkpilespawn_chance | конвар | 0.07 | defines the chance for scientists to spawn at NPC junkpiles. (Default: 0.1) |
| ai.npc_max_junkpile_count | конвар | 30 | npc_max_junkpile_count define how many npcs can spawn into the world at junkpiles at the same time (does not include monuments) (Default: 30) |
| ai.npc_max_population_military_tunnels | конвар | 3 | npc_max_population_military_tunnels defines the size of the npc population at military tunnels. (default: 3) |
| ai.npc_max_roam_multiplier | конвар | 3 | This is multiplied with the max roam range stat of an NPC to determine how far from its spawn point the NPC is allowed to roam. (default: 3) |
| ai.npc_only_hurt_active_target_in_safezone | конвар | True | If npc_only_hurt_active_target_in_safezone is true, npcs won't any player other than their actively targeted player when in a safe zone. (default: true) |
| ai.npc_patrol_point_cooldown | конвар | 5 | npc_patrol_point_cooldown defines the cooldown time on a patrol point until it's available again (default: 5) |
| ai.npc_reasoning_system_tick_rate_multiplier | конвар | 1 | The rate at which we tick the reasoning system. Minimum value is 1, as it multiplies with the tick-rate of the fixed AI tick rate of 0.1 (Default: 1) |
| ai.npc_respawn_delay_max_military_tunnels | конвар | 1920 | npc_respawn_delay_max_military_tunnels defines the maximum delay between spawn ticks at military tunnels. (default: 1920) |
| ai.npc_respawn_delay_min_military_tunnels | конвар | 480 | npc_respawn_delay_min_military_tunnels defines the minimum delay between spawn ticks at military tunnels. (default: 480) |
| ai.npc_sensory_system_tick_rate_multiplier | конвар | 5 | The rate at which we tick the sensory system. Minimum value is 1, as it multiplies with the tick-rate of the fixed AI tick rate of 0.1 (Default: 5) |
| ai.npc_spawn_on_cargo_ship | конвар | True | Spawn NPCs on the Cargo Ship. (default: true) |
| ai.npc_spawn_on_deep_sea_islands | конвар | True | Spawn NPCs on deep sea islands (default: false) |
| ai.npc_spawn_on_junkpile | конвар | True | Spawn NPCs on junkpiles (default: true) |
| ai.npc_spawn_per_tick_max_military_tunnels | конвар | 1 | npc_spawn_per_tick_max_military_tunnels defines how many can maximum spawn at once at military tunnels. (default: 1) |
| ai.npc_spawn_per_tick_min_military_tunnels | конвар | 1 | npc_spawn_per_tick_min_military_tunnels defineshow many will minimum spawn at once at military tunnels. (default: 1) |
| ai.npc_speed_crouch_run | конвар | 0.25 | npc_speed_crouch_run define the speed of an npc when in the crouched run state, and should be a number between 0 and 1. (Default: 0.25) |
| ai.npc_speed_crouch_walk | конвар | 0.1 | npc_speed_walk define the speed of an npc when in the crouched walk state, and should be a number between 0 and 1. (Default: 0.1) |
| ai.npc_speed_run | конвар | 0.4 | npc_speed_walk define the speed of an npc when in the run state, and should be a number between 0 and 1. (Default: 0.4) |
| ai.npc_speed_sprint | конвар | 1 | npc_speed_walk define the speed of an npc when in the sprint state, and should be a number between 0 and 1. (Default: 1.0) |
| ai.npc_speed_walk | конвар | 0.18 | npc_speed_walk define the speed of an npc when in the walk state, and should be a number between 0 and 1. (Default: 0.18) |
| ai.npc_use_new_aim_system | конвар | True | If npc_use_new_aim_system is true, npcs will miss on purpose on occasion, where the old system would randomize aim cone. (default: true) |
| ai.npc_use_thrown_weapons | конвар | True | If npc_use_thrown_weapons is true, npcs will throw grenades, etc. This is an experimental feature. (default: true) |
| ai.npc_valid_aim_cone | конвар | 0.8 | npc_valid_aim_cone defines how close their aim needs to be on target in order to fire. (default: 0.8) |
| ai.npc_valid_mounted_aim_cone | конвар | 0.92 | npc_valid_mounted_aim_cone defines how close their aim needs to be on target in order to fire while mounted. (default: 0.92) |
| ai.npcbarksenabled | конвар | False | |
| ai.npchealthmultiplier | конвар | 1 | Global health multiplier applied to all NPCs; 1.0 = normal, 2.0 = double health; useful for difficulty scaling without modifying individual NPC prefabs |
| ai.npcswimming | конвар | True | When enabled, NPCs can enter and swim in water; disable to prevent all NPCs from entering water bodies |
| ai.ocean_critters_movement_frametime | конвар | 0.2 | Target frame time in seconds for the Ocean Critters swimming movement budget |
| ai.ocean_patrol_path_iterations | конвар | 100000 | Maximum number of path-finding iterations used when calculating NPC ocean patrol routes; higher values produce better paths at more CPU cost |
| ai.printignoredplayers | команда | — | Print a lost of all the players in the AI ignore list. |
| ai.printorkilloffnavscientists | команда | — | Print a list of all scientists that are off the navmesh. Optionally kill them off by passing true as the first argument. |
| ai.releasenpc | команда | — | Releases every NPC selected with ai.selectnpc and hands them back to their normal AI. |
| ai.removeignoreplayer | команда | — | Remove a player (or command user if no player is specified) from the AIs ignore list. |
| ai.scientist_spawners_enabled | конвар | True | Do any kind of scientists spawn on the map (default: true) |
| ai.selectnpc | команда | — | Adds the NPC you are looking at to your selection so ai.movenpc can order it around. |
| ai.selectnpclookatserver | команда | — | Editor-only: finds the NPC entity with the given network ID on the server and selects its game object in the Unity editor hierarchy |
| ai.selectnpcsinrange | команда | — | Adds every commandable NPC around you to your selection. Optional radius in metres - defaults to ai.debugmoveselectrange. |
| ai.sensetime | конвар | 1 | How frequently in seconds the NPC sensory system updates its awareness of nearby entities; higher values reduce CPU cost but make NPCs slower to react |
| ai.setdestinationsamplenavmesh | конвар | True | When enabled, NavMesh destinations are sampled to the nearest valid NavMesh position before being set; prevents NPCs getting stuck off-mesh |
| ai.setnpcreactiontime | команда | — | The time it takes for a NPC to fully notice a player standing right in front of them, in seconds. |
| ai.showdistributions | команда | — | Editor-only: teleports the caller to a top-down view, fills NPC populations, then draws DDraw labels and lines showing each NPC category and closest neighbour |
| ai.showstate | команда | — | |
| ai.showstateflashduration | конвар | 1.5 | How long (in seconds) a value that has just moved stays coloured in the ai.showState read-out; 0 stops it colouring at all |
| ai.sleepwake | конвар | True | When enabled, AI information zones can sleep inactive NPCs and wake them when players approach; disable to keep all NPCs awake at all times |
| ai.sleepwakestats | команда | — | Prints statistics about AI sleeping zones: how many zones are sleepable, how many are sleeping, and the total count of sleeping entities |
| ai.smokegrenadenpcradius | конвар | 4 | Radius in metres within which a thrown smoke grenade suppresses NPC vision and targeting |
| ai.spliceupdates | конвар | True | When enabled, AI updates are spliced across multiple frames to spread CPU cost; disable to run all AI updates synchronously every tick |
| ai.think | конвар | True | When enabled, AI entities run their brain Think() logic each tick; disable to freeze all AI decision-making while leaving entities in place |
| ai.tickrate | конвар | 5 | Number of AI think ticks per second; default is 5 (every 200ms); higher values make AI more responsive at higher CPU cost |
| ai.usecalculatepath | конвар | True | When enabled, NavMesh path calculation uses the full CalculatePath API; disable to use the simpler SetDestination fallback only |
| ai.usegrid | конвар | True | When enabled, AI uses the spatial grid for entity queries; disable to fall back to brute-force entity iteration for debugging spatial query issues |
| ai.usesetdestinationfallback | конвар | True | When enabled, falls back to SetDestination if CalculatePath fails to find a valid path to the target |
| ai.wakesleepingai | команда | — | Wakes all currently sleeping AI information zones, forcing all sleeping NPCs within them to become active; reports zones and entity counts woken |
| ai.watchedangle | конвар | 50 | The angle under which the AI will think it's being watched by another entity |
| aibrainsenses.humanknownplayerslosupdateinterval | конвар | 0.2 | Interval in seconds between line-of-sight update ticks for human-type NPCs tracking known player positions |
| aibrainsenses.knownplayerslosupdateinterval | конвар | 0.5 | Interval in seconds between line-of-sight update ticks for all NPC types tracking known player positions |
| aibrainsenses.updateinterval | конвар | 0.5 | Interval in seconds between full AI brain senses update ticks; controls how frequently NPCs refresh their awareness of surroundings |
| aiinformationzone.usesimpleloscheck | конвар | False | |
| aimanager.ai_dormant | конвар | True | If ai_dormant is true, any npc outside the range of players will render itself dormant and take up less resources, but wildlife won't simulate as well. |
| aimanager.ai_dormant_max_wakeup_per_tick | конвар | 30 | ai_dormant_max_wakeup_per_tick defines the maximum number of dormant agents we will wake up in a single tick. (default: 30) |
| aimanager.ai_htn_animal_tick_budget | конвар | 4 | ai_htn_animal_tick_budget defines the maximum amount of milliseconds ticking htn animal agents are allowed to consume. (default: 4 ms) |
| aimanager.ai_htn_player_junkpile_tick_budget | конвар | 4 | ai_htn_player_junkpile_tick_budget defines the maximum amount of milliseconds ticking htn player junkpile agents are allowed to consume. (default: 4 ms) |
| aimanager.ai_htn_player_tick_budget | конвар | 4 | ai_htn_player_tick_budget defines the maximum amount of milliseconds ticking htn player agents are allowed to consume. (default: 4 ms) |
| aimanager.ai_htn_use_agency_tick | конвар | True | If ai_htn_use_agency_tick is true, the ai manager's agency system will tick htn agents at the ms budgets defined in ai_htn_player_tick_budget and ai_htn_animal_tick_budget. If it's false, each agent registers with the invoke system individually, with no frame-budget restrictions. (default: true) |
| aimanager.ai_to_player_distance_wakeup_range | конвар | 160 | If an agent is beyond this distance to a player, it's flagged for becoming dormant. |
| aimanager.nav_disable | конвар | False | If set to true the navmesh won't generate.. which means Ai that uses the navmesh won't be able to move |
| aimanager.nav_obstacles_carve_state | конвар | 2 | nav_obstacles_carve_state defines which obstacles can carve the terrain. 0 - No carving, 1 - Only player construction carves, 2 - All obstacles carve. |
| aimanager.nav_wait | конвар | True | If true we'll wait for the navmesh to generate before completely starting the server. This might cause your server to hitch and lag as it generates in the background. |
| aimanager.pathfindingiterationsperframe | конвар | — | The maximum amount of nodes processed each frame in the asynchronous pathfinding process. Increasing this value will cause the paths to be processed faster, but can cause some hiccups in frame rate. Default value is 100, a good range for tuning is between 50 and 500. |
| aimanager.setdestination_navmesh_failsafe | конвар | False | If set to true, npcs will attempt to place themselves on the navmesh if not on a navmesh when set destination is called. |
| aimountedweaponcontroller.burst_length | конвар | 3 | |
| aimountedweaponcontroller.fire_rate | конвар | 0.125 | |
| aimountedweaponcontroller.time_between_bursts | конвар | 3 | |
| airfieldairdropterminal.force_charge | команда | — | |
| airfieldairdropterminal.force_shortcircuit | команда | — | |
| airfieldcallchinookterminal.force_charge | команда | — | |
| airfieldcallchinookterminal.force_shortcircuit | команда | — | |
| aithinkmanager.animalframebudgetms | конвар | 2 | How many miliseconds to budget for processing animal AI entities per server frame |
| aithinkmanager.framebudgetms | конвар | 2 | How many miliseconds to budget for processing AI entities per server frame |
| aithinkmanager.petframebudgetms | конвар | 1 | How many miliseconds to budget for processing pet AI entities per server frame |
| analytics.analytics_bulk_container_url | конвар | — | Azure blob container url for use with client secret authentication |
| analytics.analytics_bulk_upload_url | конвар | — | Azure blob container url + SAS token, enables a more efficient upload method |
| analytics.analytics_header | конвар | X-API-KEY | Header key of secret when uploading analytics |
| analytics.analytics_secret | конвар | | Header secret value when uploading analytics |
| analytics.azure_client_id | конвар | — | Azure client id for authentication |
| analytics.azure_client_secret | конвар | — | Azure client secret for authentication |
| analytics.azure_tenant_id | конвар | — | Azure tenant id for authentication |
| analytics.dryrun | конвар | — | Executes entire flow without actually sending out anything |
| analytics.gameplay_analytics | конвар | — | Toggle whether gameplay analytics is collected |
| analytics.gameplay_rpc_analytics | конвар | True | Toggle whether gameplay rpc logging is collected |
| analytics.gameplay_tick_analytics | конвар | — | Toggle whether gameplay tick analytics is collected |
| analytics.log | конвар | — | |
| analytics.performance_analytics | конвар | True | Toggle to turn off server performance collection |
| analytics.resetstats | команда | — | |
| analytics.server_analytics_url | конвар | https://gw.facepunch.com/analytics/rust/server | |
| analytics.stats | команда | — | |
| analytics.tablestats | команда | — | |
| analytics.uploaderstats | команда | — | |
| antihack.admincheat | конвар | True | are admins allowed to use their admin cheat |
| antihack.build_inside_check | конвар | 2 | whether or not to check for building being done on the wrong side of something (e.g. inside rocks). 0 = Disabled, 1 = Info only, 2 = Enabled |
| antihack.build_losradius | конвар | 0.01 | line of sight sphere cast radius, 0 == raycast |
| antihack.build_losradius_sleepingbag | конвар | 0.3 | line of sight sphere cast radius, 0 == raycast |
| antihack.build_terraincheck | конвар | True | whether or not to include terrain in the build LOS checks |
| antihack.build_vehiclecheck | конвар | True | whether or not to include vehicles in the build LOS checks |
| antihack.check_mount_distance | конвар | 1 | Should the server check the distance to mountable.maxMountDistance? 0 = off, 1 = for seats with 'checkPlayerLosOnMount' enabled, 2 = always |
| antihack.debuglevel | конвар | 1 | 0 == silent, 1 == print max violation, 2 == print nonzero violation, 3 == print any violation except noclip, 4 == print any violation |
| antihack.enforcementlevel | конвар | 1 | 0 == no enforcement, 1 == kick, 2 == ban (DISABLED) |
| antihack.explosive_vehicle_parent_damage_deployables | конвар | False | Should explosives parented to vehicles damage deployables |
| antihack.eye_clientframes | конвар | 2 | eye client frames to include in delay, lower value = more false positives |
| antihack.eye_distance_parented_mounted_forgiveness | конвар | 2 | eye distance forgiveness for parented or mounted players, lower value = more false positives |
| antihack.eye_forgiveness | конвар | 0.4 | eye distance forgiveness, lower value = more false positives |
| antihack.eye_history_forgiveness | конвар | 0.1 | how much forgiveness to add when checking the distance between player tick history and player eye history |
| antihack.eye_history_penalty | конвар | 100 | violation penalty to hand out when eye history mismatch is detected |
| antihack.eye_losradius | конвар | 0.158 | line of sight sphere cast radius, 0 == raycast |
| antihack.eye_noclip_backtracking | конвар | 0.01 | collider backtracking when checking for noclipping |
| antihack.eye_noclip_cutoff | конвар | 0.06 | distance at which to start testing eye noclipping |
| antihack.eye_noclip_margin | конвар | 0.25 | collider margin when checking for noclipping |
| antihack.eye_penalty | конвар | 0 | violation penalty to hand out when eye hack is detected |
| antihack.eye_protection | конвар | 4 | 0 == disabled, 1 == distance, 2 == distance + LOS, 3 = distance + LOS + altitude, 4 = distance + LOS + altitude + noclip, 5 = distance + LOS + altitude + noclip + history |
| antihack.eye_serverframes | конвар | 2 | eye server frames to include in delay, lower value = more false positives |
| antihack.eye_terraincheck | конвар | True | whether or not to include terrain in the eye LOS checks |
| antihack.eye_vehiclecheck | конвар | True | whether or not to include vehicles in the eye LOS checks |
| antihack.flyhack_extrusion | конвар | 2 | collider downwards extrusion when checking for flyhacking |
| antihack.flyhack_forgiveness_horizontal | конвар | 1.5 | distance threshold to assume flyhacking, lower value = more false positives |
| antihack.flyhack_forgiveness_horizontal_inertia | конвар | 10 | distance threshold to assume flyhacking, lower value = more false positives |
| antihack.flyhack_forgiveness_vertical | конвар | 1 | distance threshold to assume flyhacking, lower value = more false positives |
| antihack.flyhack_forgiveness_vertical_inertia | конвар | 7 | distance threshold to assume flyhacking, lower value = more false positives |
| antihack.flyhack_margin | конвар | 0.1 | collider margin when checking for flyhacking |
| antihack.flyhack_maxsteps | конвар | 15 | movement curve max steps, lower value = more false positives |
| antihack.flyhack_penalty | конвар | 100 | violation penalty to hand out when flyhack is detected |
| antihack.flyhack_protection | конвар | 3 | 0 == disabled, 1 == client, 2 == capsule, 3 == curve |
| antihack.flyhack_reject | конвар | True | whether or not to reject movement when flyhack is detected |
| antihack.flyhack_stepsize | конвар | 0.1 | movement curve step size, lower value = less false positives |
| antihack.forceposition | конвар | True | whether or not to force the position on the client |
| antihack.hotbar_network_mode | конвар | 0 | Should the server send the hotbar to other players, 0 = always, 1 = only held entities |
| antihack.impact_effect_distance_forgiveness | конвар | 0.45 | maximum distance an impact effect can be from the entities bounds |
| antihack.maxdeltatime | конвар | 1 | max allowed client tick interval delta time, lower value = more false positives |
| antihack.maxdesync | конвар | 0.8 | max allowed client desync, lower value = more false positives |
| antihack.maxviolation | конвар | 100 | violation value above this results in enforcement |
| antihack.melee_backtracking | конвар | 0.01 | melee backtracking when checking for LOS |
| antihack.melee_clientframes | конвар | 2 | melee client frames to include in delay, lower value = more false positives |
| antihack.melee_entity_bounds_radius | конвар | 0.05 | melee collider bounds validation radius for hit entities, higher value = more forgiveness |
| antihack.melee_forgiveness | конвар | 0.5 | melee distance forgiveness in percent, lower value = more false positives |
| antihack.melee_los_entity_realpos | конвар | True | whether or not to verify line of sight to the entity's real server-side position |
| antihack.melee_los_entity_realpos_distance | конвар | 1.3 | max tolerance for distance between hit pos and closest bound pos |
| antihack.melee_losforgiveness | конвар | 0.2 | line of sight directional forgiveness when checking eye or center position |
| antihack.melee_penalty | конвар | 0 | violation penalty to hand out when melee hack is detected |
| antihack.melee_protection | конвар | 5 | 0 == disabled, 1 == initiator, 2 == initiator + target, 3 == initiator + target + LOS, 4 == initiator + target + LOS + tickhistory, 5 == entity collider Overlap Sphere (bounds validation) |
| antihack.melee_serverframes | конвар | 2 | melee server frames to include in delay, lower value = more false positives |
| antihack.melee_terraincheck | конвар | True | whether or not to include terrain in the melee LOS checks |
| antihack.melee_vehiclecheck | конвар | True | whether or not to include vehicles in the melee LOS checks |
| antihack.mesh_inside_check_distance | конвар | 50 | the maximum distance we check for for inside mesh |
| antihack.modelstate | конвар | True | use antihack to verify model state sent by players |
| antihack.noclip_backtracking | конвар | 0.01 | collider backtracking when checking for noclipping |
| antihack.noclip_margin | конвар | 0.16 | collider margin when checking for noclipping |
| antihack.noclip_margin_dismount | конвар | 0.22 | collider margin when checking for noclipping on dismount |
| antihack.noclip_maxsteps | конвар | 15 | movement curve max steps, lower value = more false positives |
| antihack.noclip_penalty | конвар | 0 | violation penalty to hand out when noclip is detected |
| antihack.noclip_protection | конвар | 3 | 0 == disabled, 1 == ray, 2 == sphere, 3 == curve |
| antihack.noclip_reject | конвар | True | whether or not to reject movement when noclip is detected |
| antihack.noclip_stepsize | конвар | 0.1 | movement curve step size, lower value = less false positives |
| antihack.objectplacement | конвар | True | use antihack to verify object placement by players |
| antihack.parenthistory | конвар | True | use parent position history for mounted player projectile validation (more accurate, uses ~192 bytes per mounted player) |
| antihack.projectile_anglechange | конвар | 60 | projectile penetration angle change, lower value = more false positives |
| antihack.projectile_backtracking | конвар | 0.01 | projectile backtracking when checking for LOS |
| antihack.projectile_clientframes | конвар | 2 | projectile client frames to include in delay, lower value = more false positives |
| antihack.projectile_damagedepth | конвар | 2 | how often a projectile is allowed to penetrate something before its damage is ignored |
| antihack.projectile_defaultcheck | конвар | True | whether or not to include default layer in the projectile LOS checks |
| antihack.projectile_deployedcheck | конвар | True | whether or not to include deployed layer in the projectile LOS checks |
| antihack.projectile_desync | конвар | 1 | projectile desync forgiveness, lower value = more false positives |
| antihack.projectile_distance_forgiveness_minimum | конвар | 25 | minimum distance before we verify client projectile distance mismatch, lower value = more false positives |
| antihack.projectile_forgiveness | конвар | 0.5 | projectile speed forgiveness in percent, lower value = more false positives |
| antihack.projectile_impactspawndepth | конвар | 1 | how often a projectile is allowed to penetrate something before its impact spawn is ignored |
| antihack.projectile_losforgiveness | конвар | 0.2 | line of sight directional forgiveness when checking eye or center position |
| antihack.projectile_penalty | конвар | 0 | violation penalty to hand out when projectile hack is detected |
| antihack.projectile_positionoffset | конвар | True | whether or not to compensate for the client / server vehicle position offset |
| antihack.projectile_protection | конвар | 6 | 0 == disabled, 1 == speed, 2 == speed + entity, 3 == speed + entity + LOS, 4 == speed + entity + LOS + trajectory, 5 == speed + entity + LOS + trajectory + update, 6 == speed + entity + LOS + trajectory + tickhistory |
| antihack.projectile_serverframes | конвар | 2 | projectile server frames to include in delay, lower value = more false positives |
| antihack.projectile_terraincheck | конвар | True | whether or not to include terrain in the projectile LOS checks |
| antihack.projectile_trajectory | конвар | 2 | projectile trajectory forgiveness, lower value = more false positives |
| antihack.projectile_trajectory_update | конвар | 0.02 | projectile trajectory forgiveness for projectile updates, lower value = more false positives |
| antihack.projectile_update_limit | конвар | 4 | maximum number of projectile updates to allow before rejecting damage |
| antihack.projectile_vehiclecheck | конвар | True | whether or not to include vehicles in the projectile LOS checks |
| antihack.projectile_velocitychange | конвар | 1.1 | projectile penetration velocity change, lower value = more false positives |
| antihack.relaxationpause | конвар | 10 | the time before violation values go back down |
| antihack.relaxationrate | конвар | 0.1 | the rate at which violation values go back down |
| antihack.reporting | конвар | False | report violations to the anti cheat backend |
| antihack.rpc_timer_forgiveness | конвар | 1 | How long, in seconds, can the clients progress timer deviate from the servers |
| antihack.rpcstallfade | конвар | 2.5 | time in seconds before player is no longer treated as wasStalled |
| antihack.rpcstallmode | конвар | 1 | 0 == allow RPCs from stalled players, 1 == ignore RPCs from currently stalled players, 2 == ignore RPCs from recently stalled players |
| antihack.rpcstallthreshold | конвар | 0.8 | time in seconds we can receive no ticks for before player is considered stalling |
| antihack.server_occlusion_admin_bypass | конвар | False | whether or not to ensure players are always networked to server administrators |
| antihack.server_occlusion_blocked_grid_threshold | конвар | 0 | number of blocked grids permitted before line-of-sight fails |
| antihack.server_occlusion_caching | конвар | True | whether to use server occlusion caching |
| antihack.server_occlusion_disable_los | конвар | False | whether or not to skip the line-of-sight process, this will effectively disable server occlusion |
| antihack.server_occlusion_disable_sleeper_los | конвар | False | whether or not to skip the line-of-sight process for sleepers |
| antihack.server_occlusion_neighbour_threshold | конвар | 2 | number of neighbour checks permitted before line-of-sight fails |
| antihack.server_occlusion_save_grid | конвар | True | whether to save sub grid for map to a file on first time init, faster subsequent server launching |
| antihack.server_occlusion_use_neighbour_thresholds | конвар | False | whether to use neighbour threshold limitations |
| antihack.speedhack_forgiveness | конвар | 2 | speed threshold to assume speedhacking, lower value = more false positives |
| antihack.speedhack_forgiveness_inertia | конвар | 10 | speed threshold to assume speedhacking, lower value = more false positives |
| antihack.speedhack_penalty | конвар | 0 | violation penalty to hand out when speedhack is detected |
| antihack.speedhack_protection | конвар | 3 | 0 == disabled, 1 == simple, 2 == advanced, 3 == vertical swim protection |
| antihack.speedhack_reject | конвар | True | whether or not to reject movement when speedhack is detected |
| antihack.speedhack_slopespeed | конвар | 10 | speed forgiveness when moving down slopes, lower value = more false positives |
| antihack.speedhack_water_threshold | конвар | 0.4 | server threshold before we consider a client might be swimming in water (to account for client/server waterfactor mismatch |
| antihack.stall_position_restrictions | конвар | True | whether or not to restrict entity position packets to non-stalled players |
| antihack.strict_mount_checks | конвар | 1 | Should we do extra physics checks when mounting vehicles to prevent players clipping through small gaps. 0 = off, 1 = bypass switch seats, 2 = always |
| antihack.terrain_check_geometry | конвар | False | whether or not to check for player inside geometry like rocks as well as base terrain |
| antihack.terrain_kill | конвар | True | whether or not to kill the player when terrain is detected |
| antihack.terrain_padding | конвар | 0.3 | how far to penetrate the terrain before violating |
| antihack.terrain_penalty | конвар | 100 | violation penalty to hand out when terrain is detected |
| antihack.terrain_protection | конвар | 1 | 0 == disabled, 1 == enabled |
| antihack.terrain_timeslice | конвар | 64 | how many slices to subdivide players into for the terrain check |
| antihack.terrain_vehicle_seat_padding | конвар | 0.3 | additional padding when in a vehicle seat that can come close to the terrain |
| antihack.tick_buffer_noclip_threshold | конвар | 2 | How many seconds worth of ticks can be sent before server tick finalizing before we revert to noclip_protection 2 |
| antihack.tick_buffer_preventions | конвар | True | Whether or not to enable additional tick validation measures |
| antihack.tick_buffer_reject_threshold | конвар | 3 | How many seconds worth of ticks can be sent before server tick finalizing before we reject movement |
| antihack.tick_buffer_server_lag_threshold | конвар | 0.3 | How long it should take for a server to process a frame before we decide to skip additional tick validation measures |
| antihack.tick_distance_forgiveness | конвар | 5 | How far a player is allowed to move in forgiveness scenarios |
| antihack.tick_max_distance | конвар | 1.1 | How far a player is allowed to move in a single tick |
| antihack.tick_max_distance_falling | конвар | 4 | How far a player is allowed to move in a single tick when falling |
| antihack.tick_max_distance_parented | конвар | 3 | How far a player is allowed to move in a single tick when parented |
| antihack.tickhistoryforgiveness | конвар | 0.1 | how much forgiveness to add when checking the distance from the player tick history |
| antihack.tickhistorytime | конвар | 0.5 | for how many seconds to keep a tick history to use for distance checks |
| antihack.use_legacy_mesh_inside_check | конвар | True | use the older, simpler is inside check. has several loopholes that aren't properly catered to |
| antihack.userlevel | конвар | 2 | 0 == users, 1 == admins, 2 == developers |
| apartment.adminapartmentbypass | конвар | False | Should admins be able to bypass apartment authorization checks? |
| apartment.adminapartmentnoclip | конвар | True | Should admins be able to noclip in apartments? |
| apartment.allowcombatoutsideofbreakin | конвар | True | Should combat be allowed inside apartment rooms outside of the break-in period? |
| apartment.apartmentevictiondelay | конвар | 86400 | How long should we wait before evicting a player from their apartment if they don't pay rent? |
| apartment.apartmentfreerenthours | конвар | 4 | How many hours of scrap upkeep does the apartments spawn with (so players don't see 'Eviction' vital right after renting an apartment |
| apartment.apartmentinvisibleblocker | конвар | True | Should an invisible blocker prevent guests from entering apartments that they don't have access to? |
| apartment.breakinseconds | конвар | 30 | How long a player needs to hold the break in interaction on an apartment door with a master key |
| apartment.checkoutallrooms | команда | — | Checkout every room in the apartment complex |
| apartment.checkoutroom | команда | — | |
| apartment.fakerentroom | команда | — | |
| apartment.givestalecombattrigger | команда | — | Admin test tool: injects a stale combat-zone trigger (TriggerSafeZoneOverride) into your trigger list without physically entering it, reproducing the reconnect/wake desync so you can verify safezone damage protection. Run it near a loaded apartment, then walk out into the world. |
| apartment.intruderauthseconds | конвар | 300 | How long a player stays authorized on an apartment room after breaking in with a master key |
| apartment.masterkeyprice | конвар | 1000 | How much scrap the apartment security NPC charges for a master key |
| apartment.npcsecuritydooropentime | конвар | 300 | How long should the apartment security NPC keep the door open for after being paid? |
| apartment.printapartmentfurniture | команда | — | Print list of furniture inside your room |
| apartment.printitemtax | команда | — | Print out a list of all items that apartments will tax |
| apartment.rentallrooms | команда | — | |
| apartment.rentallroomsoftype | команда | — | |
| apartment.rentroom | команда | — | |
| apartment.rentscaling | конвар | 0 | Should the rent scale based on the items you have stored inside your apartment? |
| apartment.scheduleddeath | команда | — | Test triggering the scheduled death in safezones |
| apartment.testapartmentsecuritydoor | команда | — | Test triggering the apartment security door |
| app.alarmcooldown | конвар | 30 | Cooldown time before alarms can send another notification (in seconds) |
| app.appban | команда | — | Bans a player by Steam ID from the server via the app layer, adding them to the banlist and kicking them if connected |
| app.appunban | команда | — | Removes a ban for the specified Steam ID from the server banlist, allowing the player to reconnect |
| app.endpoint | конвар | https://companion-rust.facepunch.com/api | Base address for the Rust+ companion server API |
| app.info | команда | — | Prints current server info including name, level, connected players, max players, and network address to the console |
| app.listenip | конвар | | IP address the server listens on for incoming connections; leave empty to bind to all available network interfaces |
| app.logexceptions | конвар | True | When enabled, server-side C# exceptions are written to the server log file; disabling reduces log noise on servers with known non-critical exceptions |
| app.maxconnections | конвар | 500 | Maximum number of simultaneous player connections allowed; connections above this limit are rejected with a server full message |
| app.maxconnectionsperip | конвар | 10 | Maximum simultaneous connections from the same IP address; prevents a single host from consuming all connection slots |
| app.maxmessagesize | конвар | 1048576 | Maximum allowed size in bytes of a single network message; oversized messages are dropped to prevent memory exhaustion attacks |
| app.notifications | конвар | True | Enables sending push notifications |
| app.pair | команда | — | |
| app.port | конвар | — | UDP port number the server listens on; default is 28015; must be open in firewall for players to connect |
| app.publicip | конвар | | Public IP address advertised to the Steam server browser; leave empty to auto-detect; set explicitly if behind NAT |
| app.queuelimit | конвар | 100 | Max number of queued messages - set to 0 to disable message processing |
| app.regeneratetoken | команда | — | |
| app.retry_initialize | команда | — | Retry initializing the Rust+ companion server if it previously failed, pass true to restart it even if it's already running |
| app.serverid | конвар | | |
| app.update | конвар | True | Disables updating entirely - emergency use only |
| audio.advancedocclusion | конвар | False | Use more advanced sound occlusion |
| audio.ambience | конвар | True | Ambience System |
| audio.debugvoicelimiting | конвар | False | When enabled, logs voice chat limiting decisions to the console, showing when players are muted due to proximity or bandwidth constraints |
| audio.enablesoundpooling | конвар | False | Enables audio source pooling, reusing AudioSource components instead of creating and destroying them each time a sound plays |
| audio.eventaudio | конвар | 1 | Volume |
| audio.framebudget | конвар | 0.3 | Max ms per frame to spend updating sounds |
| audio.game | конвар | 1 | Volume |
| audio.hqsoundfade | конвар | False | Use higher quality sound fades on some sounds |
| audio.instruments | конвар | 1 | Volume |
| audio.master | конвар | 1 | Volume |
| audio.minupdatefraction | конвар | 0.1 | Minimum fraction of the audio source pool updated per frame; higher values keep more audio sources in sync at the cost of CPU time |
| audio.musicvolume | конвар | 1 | Volume |
| audio.musicvolumemenu | конвар | 1 | Volume |
| audio.printenginesounds | команда | — | print active engine sound info |
| audio.printsounds | команда | — | Prints a list of all currently active audio sources with their asset names, volume, and world position |
| audio.speakers | конвар | — | Volume |
| audio.ui | конвар | 1 | Volume |
| audio.videoplayer | конвар | 1 | Volume |
| audio.voiceprops | конвар | 1 | Volume |
| audio.voices | конвар | 1 | Volume |
| autoturret.ammo_update_ms | конвар | 0.1 | How many milliseconds to spend on ammo updating per frame |
| autoturret.scan_budget_ms | конвар | 0.5 | How many milliseconds to spend on target scanning per frame |
| autoturret.tick_update_ms | конвар | 1 | How many milliseconds to spend on a tick per frame |
| ballistagun.debug | конвар | — | When enabled, draws debug visualisations for this system (seismic sensor range sphere, escape capture state, etc.); editor/admin-only |
| ballistagun.reload | команда | — | Forces the ballista gun nearest to the calling admin player to reload immediately; admin-only |
| baseboat.debug_eject_ai | конвар | False | When enabled, logs debug information about AI ejection events when passengers are removed from boat seats |
| baseboat.do_shore_drift | конвар | True | When enabled, boats without nearby players will slowly drift toward the shore after the shore drift delay elapses |
| baseboat.drift_speed | конвар | 1 | Shore drift speed in metres per second |
| baseboat.generate_paths | конвар | True | When enabled, procedural patrol paths are generated for boats at server startup; false in editor to skip path generation during testing |
| baseboat.seconds_between_shore_drift | команда | — | Seconds between shore drift teleport ticks |
| baseboat.seconds_until_shore_drift | команда | — | Seconds until boat starts drifting to shore if there's nobody around |
| basefirework.maxactivefireworks | конвар | 25 | |
| basefishingrod.forcefail | конвар | False | When enabled, all fishing attempts fail immediately; cheat for testing failed-catch animations and UI feedback |
| basefishingrod.forcesuccess | конвар | False | When enabled, all fishing attempts succeed immediately regardless of bite probability; cheat for testing fishing catch logic |
| basefishingrod.immediatehook | конвар | False | When enabled, fish bite the hook immediately after casting without any wait time; cheat for testing bite response |
| basemetaldetector.detectlongrangetick | конвар | 1 | Interval in seconds between long-range detectability checks for buried objects; longer interval saves CPU for distant searches |
| basemetaldetector.detectminmovementdistance | конвар | 1 | Minimum distance in metres the player must move before a new long-range detection check is triggered |
| basemetaldetector.nearestdistancetick | конвар | 0.25 | Interval in seconds between nearest-detectable-object distance checks performed by the metal detector |
| basemission.missionpervalidstatecooldown | конвар | 3 | Minimum time (s) between revalidating individual missions via updateMissionValidStateWorkQueue |
| basemission.missionsenabled | конвар | True | When enabled, missions are available and can be assigned to players; disable to globally suppress mission generation and assignment on the server |
| basemission.missionvalidstateworkqueuebudget | конвар | 0.1 | How long per frame (ms) to spend processing updateMissionValidStateWorkQueue |
| basemission.missionvalidstateworkqueuecooldown | конвар | 3 | Minimum time (s) between starting runs of updateMissionValidStateWorkQueue |
| basemission.profilenextmissionsvalidstateworkqueue | команда | — | Generate a performance capture containing the next run of updateMissionValidStateWorkQueue |
| basemountable.canpausemountedplayersync | конвар | False | Toggles the usage of mountable MountedPlayerSync optimisations (only used by boat scientists currently) |
| basenavigator.basenavmovementframeinterval | конвар | 2 | How many frames between base navigation movement updates |
| basenavigator.maxstepupdistance | конвар | 1.7 | The max step-up height difference for pet base navigation |
| basenavigator.navtypedistance | конвар | 1 | |
| basenavigator.navtypeheightoffset | конвар | 0.5 | |
| basenavigator.stucktriggerduration | конвар | 10 | How long we are not moving for before trigger the stuck event |
| basepet.movementupdatebudgetms | конвар | 1 | How many miliseconds to budget for processing pet movements per frame |
| basepet.onlyqueuebasenavmovements | конвар | True | |
| basepet.queuedmovementsallowed | конвар | True | |
| baseplayer.allowrelationshipserverocclusion | конвар | True | When enabled, server occlusion is taken into account when updating player relationship visibility data; saved between restarts |
| baseplayer.botcolliderframebudgetms | конвар | 0.05 | Per-frame CPU budget in milliseconds for the bot collider work queue that updates NPC physics colliders |
| baseplayer.lifestoryframebudgetms | конвар | 0.25 | How many milliseconds to budget for processing life story updates per frame |
| baseplayer.relationshipupdatequeueframebudgetms | конвар | 0.05 | Per-frame CPU budget in milliseconds for processing the player relationship (contacts/team) update queue |
| baseragdoll.debug_vis | конвар | — | When enabled, draws debug visualisations for ragdoll physics state including bone positions and velocities |
| basesculpture.applyrandomshapes | команда | — | |
| basesculpture.listsavedsculptures | команда | — | |
| basesculpture.loadsculpture | команда | — | |
| basesculpture.logmeshstats | конвар | false | When enabled, logs mesh vertex and triangle count statistics when a sculpture mesh is applied or modified |
| basesculpture.printcrc | команда | — | |
| basesculpture.savesculpture | команда | — | |
| basesculpture.useconvexcolliders | конвар | false | Use convex colliders for generated blocks on both the client and server - slower to generate but blocks holes, only effects future modifications |
| basesiegeweapon.outsidedecayminutes | конвар | 600 | How many minutes before a siege weapon loses all its health while outside |
| basesubmarine.deepwaterdecayminutes | конвар | 120 | How long before a submarine loses all its health while in deep water |
| basesubmarine.outsidedecayminutes | конвар | 180 | How long before a submarine loses all its health while outside. If it's in deep water, deepwaterdecayminutes is used |
| basesubmarine.oxygenminutes | конвар | 10 | How long a submarine can stay underwater until players start taking damage from low oxygen |
| batching.batch_industrial_pipes | конвар | False | When enabled, industrial pipe meshes are included in the mesh batching pass; disabled by default as pipes frequently change state |
| batching.enabled | конвар | True | Enables the mesh batching system, which combines nearby static meshes into single draw calls to reduce rendering overhead |
| batching.renderer_capacity | конвар | 30000 | Maximum number of renderer components the batching system will process; increase for dense scenes, decrease to limit memory use |
| batching.renderer_submeshes | конвар | 2 | Maximum number of sub-meshes a renderer can have to be eligible for batching; complex multi-material meshes above this threshold are excluded |
| batching.renderer_threading | конвар | True | Enables multi-threaded renderer processing for the batching system, spreading batch rebuild work across CPU cores |
| batching.renderer_vertices | конвар | 1000 | Maximum vertex count of a single mesh allowed into a batch; meshes above this limit are excluded from batching |
| batching.verbose | конвар | 0 | Verbosity level for static batching debug output; 0 = off, higher values print more detail about batch operations to the console |
| batteringram.maxbuildingblockgrade | конвар | 2 | Maximum building block upgrade grade (0=twig,1=wood,2=stone,3=metal,4=top tier) that the battering ram can damage; default 2 (stone) |
| batteringramhead.hurt | команда | — | Deals the specified amount of damage to the battering ram head entity nearest to the calling admin player; admin-only |
| bear.population | конвар | 2 | Population active on the server, per square km |
| beehive.updatehiveinterval | конвар | 120 | How long before a Beehive will update |
| beehive.updatehivestatsinterval | конвар | 120 | How long before the Beehive will perform temperature and inside checks |
| beehive.xpincreaseperhoneycomb | конвар | 2 | How much the Nucleus's XP should be increased per honeycomb generated |
| beeswarmai.breakrange | конвар | 15 | Range to leave current target alone (should be higher than search) |
| beeswarmai.disable | конвар | False | |
| beeswarmai.flamesettingdistance | конвар | 5.5 | How far away fire has to be to set the swarm on fire |
| beeswarmai.killwithouttargettime | конвар | 150 | How long a swarm will stick around without a target |
| beeswarmai.searchrange | конвар | 10 | Range to find new targets |
| beeswarmai.think_budget_ms | конвар | 0.1 | How many milliseconds to spend on thinking per frame |
| beeswarmai.waterthreshold | конвар | 0.6 | How much water a player needs to be in to be ignored |
| beeswarmmaster.amounttospawn | конвар | 3 | How many child swarms a master swarm will create |
| beeswarmmaster.killwithoutatargettime | конвар | 150 | How long a master swarm will stick around without a target |
| beeswarmmaster.secondsbetweenspawns | конвар | 60 | How long before a master swarm will create a child |
| bigwheelgame.spinfrequencyseconds | конвар | 45 | |
| bike.doplayerdamage | конвар | True | Can bike crashes cause damage or death to the rider? |
| bike.motorbikemonumentpopulation | конвар | 1 | Motorbike population in monuments |
| bike.outsidedecayminutes | конвар | 1440 | How long before a bike loses all its health while outside |
| bike.pedalmonumentpopulation | конвар | 1 | Pedal bike population in monuments |
| bike.pedalroadsidepopulation | конвар | 1 | Pedal bike population active on the server (roadside spawns) |
| bike.playerdamageragdolltheshold | конвар | 10 | Amount of collision damage on a bike required to ragdoll the player |
| blackjackmachine.maxbet | конвар | 500 | Maximum initial bet per round |
| boar.population | конвар | 5 | Population active on the server, per square km |
| boatai.allow_sleeping | конвар | False | When enabled, boat AI entities can enter a sleep state when no players are nearby; reduce CPU usage for idle boats |
| boatai.avoidance_update_interval | конвар | 0.8 | How often to update the avoidance cache. Lower number means a more accurate cache at the expensive of performance. |
| boatai.boat_ai_frame_budget_ms | конвар | 0.3 | How long per frame to spend on boat ai |
| boatai.draw_debugs | конвар | False | When enabled, draws DDraw visualisations of boat AI steering, avoidance, and pathfinding state |
| boatai.enable_mount_sync_distance | конвар | 750 | Distance players need to be to start syncing mounted seats |
| boatai.max_speed_percentage | конвар | 0.9 | Maximum speed as a fraction of the boat's top speed that AI-controlled boats will use; default 0.9; saved and shown in admin UI |
| boatai.print_debugs | конвар | False | When enabled, logs verbose boat AI decision-making output to the server console each AI tick |
| boatai.seconds_until_sleep | конвар | 30 | Number of seconds a boat AI will wait without player interaction before entering sleep mode; default 30s |
| boatbuildingblock.alwayrotatable | конвар | True | |
| boatbuildingblock.alwaysdemolishable | конвар | True | |
| boatbuildingblock.forwarddamagetoparentboat | конвар | True | When enabled, damage dealt to a building block attached to a boat is forwarded up to the parent boat entity |
| boatbuildingblockdecay.decaydelayminutes | конвар | 30 | Multiplied by the base BuildingBlockDecay duration |
| boatbuildingblockdecay.decaydurationmultiplier | конвар | 1 | Multiplied by the base BuildingBlockDecay duration |
| boatbuildingstation.autocloseplayercheckinterval | конвар | 150 | |
| boatbuildingstation.autocloseplayerchecktriggercount | конвар | 2 | |
| boatbuildingstation.editfinishuseinterval | конвар | 5 | |
| boatbuildingstation.globaleditfinishuseinterval | конвар | 0 | When set above zero, enables a global shared cooldown for boat edit/finishing. |
| boatbuildingstation.logboatbuildingevents | конвар | False | |
| boatbuildingstation.max_bbs | конвар | 1 | |
| boatbuildingstation.print_stats | команда | — | |
| boatbuildingstation.staticstationsenabled | конвар | True | When disabled, any spawned static BBS will destroy themselves on spawn |
| boombox.backtracklength | конвар | 30 | How many hops a speaker or boombox will traverse to find a connection |
| boombox.clearradiobyuser | команда | — | Clears all radio station data set by the given Steam64 ID from all deployed and held boomboxes on the server |
| boombox.serverurllist | конвар | — | A list of radio stations that are valid on this server. Format: NAME,URL,NAME,URL,etc |
| bot.crouch_server | команда | — | Sets the ducked/crouching model state on a specific bot by name or Steam ID; used to control bot posture in testing scenarios |
| bot.sv_exec_command | команда | — | Executes a console command on a specific bot player by name or Steam ID; hidden from admin UI as it is intended for bot scripting only |
| bot.sv_exec_command_all | команда | — | Executes a console command on every bot player currently on the server; hidden from admin UI |
| bot.sv_exec_command_sphere | команда | — | Executes a console command on all bot players within a given radius of the calling admin; hidden from admin UI |
| bradley.enabled | конвар | True | When false, prevents the Bradley APC from spawning or respawning on the server |
| bradley.quickrespawn | команда | — | Forces an immediate Bradley APC respawn, bypassing the normal respawn delay; admin only |
| bradley.respawndelayminutes | конвар | 60 | Number of minutes after the Bradley APC is destroyed before it respawns at its patrol path; default is 60 minutes |
| bradley.respawndelayvariance | конвар | 1 | Random variance multiplier applied to respawnDelayMinutes; a value of 1.0 means the actual delay is randomly chosen between 0 and respawnDelayMinutes |
| bradleyapc.deployattackdistancemax | конвар | 50 | |
| bradleyapc.deployhealthrangemax | конвар | 0.5 | |
| bradleyapc.deployhealthrangemin | конвар | 0.4 | |
| bradleyapc.deployinterval | конвар | 1 | |
| bradleyapc.deployondamagecheckinterval | конвар | 1 | |
| bradleyapc.killscientistsonbradleydeath | конвар | False | |
| bradleyapc.mountafternotattackedduration | конвар | 180 | |
| bradleyapc.mountafternotfiredduration | конвар | 60 | |
| bradleyapc.mountafternottargetsduration | конвар | 60 | |
| bradleyapc.scientistredeploymentmininterval | конвар | 60 | |
| bradleyapc.spawnroadbradley | команда | — | |
| bradleyapc.usesmokegrenades | конвар | True | |
| buoyancy.use_batching | конвар | True | When enabled, buoyancy point physics updates are batched together each fixed update for better CPU efficiency |
| burieditems.burieditemweight | конвар | 100 | Metal detector loot weight is 100. |
| burieditems.buryitemchance | конвар | 0.85 | [0.0 to 1.0] |
| burieditems.expirytime | конвар | 86400 | Time in seconds before an item expires. |
| burieditems.maxburieditems | конвар | 32 | |
| camerarenderer.completionframebudgetms | конвар | 5 | Per-frame CPU budget in milliseconds for completing pending companion server camera renders |
| camerarenderer.developerpermissions | конвар | True | Enable developer-specific permissions for camera access (less restricted) |
| camerarenderer.enabled | конвар | True | When enabled, the companion server camera rendering system is active and processes camera render requests from the companion app |
| camerarenderer.entitymaxage | конвар | 5 | Maximum age in frames for a known collider entity entry in the companion server camera cache before it is evicted |
| camerarenderer.entitymaxdistance | конвар | 100 | Maximum distance in metres from the companion server camera at which entity colliders are tracked for rendering |
| camerarenderer.farplane | конвар | 250 | Far clipping plane distance in metres for companion server camera renders; default 250 |
| camerarenderer.height | конвар | 180 | Height in pixels of the companion server camera render output; default 180 |
| camerarenderer.layermask | конвар | 1218656529 | Physics layer mask used for raycasting in companion server camera depth sampling; defaults to solid, water, and player movement layers |
| camerarenderer.maxraysperframe | конвар | 100000 | Maximum number of raycasts per frame used for companion server camera depth sampling |
| camerarenderer.maxrendersperframe | конвар | 25 | Maximum number of camera render tasks that can complete per frame for companion server cameras |
| camerarenderer.nearplane | конвар | 0 | Near clipping plane distance for companion server camera renders; 0 = use default |
| camerarenderer.playermaxdistance | конвар | 30 | Maximum distance in metres at which player entities are included in companion server camera renders |
| camerarenderer.playernamemaxdistance | конвар | 10 | Maximum distance in metres at which player name labels are included in companion server camera render output |
| camerarenderer.rayjitter | конвар | 0.5 | Maximum per-axis camera rotation jitter, in sample cells, applied to each companion server camera render so a stationary camera still returns a natural scatter of ray samples instead of a rigid grid; 0 disables |
| camerarenderer.renderinterval | конвар | 0.05 | Interval in seconds between successive companion server camera render dispatches; default 0.05s (20 Hz) |
| camerarenderer.samplesperrender | конвар | 3000 | Number of raycast samples taken per companion server camera render pass for depth reconstruction |
| camerarenderer.verticalfov | конвар | 65 | Vertical field of view in degrees for companion server camera renders; default 65 |
| camerarenderer.width | конвар | 320 | Width in pixels of the companion server camera render output; default 320 |
| camerarenderermanager.pool_stats | команда | — | Prints pool statistics for the camera renderer manager including active renderer count, pooled task count, and task creation/return counters |
| cannon.adminfire | команда | — | |
| cannon.ignore_boat_mount_restrictions | конвар | False | Allows mounting cannons outside of boats for testing. |
| cargoship.cargo_escape_boat_rhib | конвар | True | |
| cargoship.debug_cargo_status | команда | — | |
| cargoship.debug_info | команда | — | |
| cargoship.dock_time | конвар | 480 | |
| cargoship.docking_debug | конвар | False | |
| cargoship.egress | команда | — | |
| cargoship.egress_duration_minutes | конвар | 10 | |
| cargoship.event_duration_minutes | конвар | 50 | |
| cargoship.event_enabled | конвар | True | |
| cargoship.loot_round_spacing_minutes | конвар | 10 | |
| cargoship.loot_rounds | конвар | 3 | |
| cargoship.refresh_loot_on_dock | конвар | True | |
| cargoship.should_dock | конвар | True | |
| cassette.clearcassettes | команда | — | Clears the saved audio recording from all cassette items currently on the server; returns count of cassettes cleared |
| cassette.clearcassettesbyuser | команда | — | Clears saved audio from all cassettes created by the given Steam64 ID; returns count of cassettes cleared |
| cassette.maxcassettefilesizemb | конвар | 5 | |
| catapult.fire | команда | — | Fire all catapults |
| catapult.reload | команда | — | Reload all catapults. 0: empty, 1: stone boulder, 2: fire bomb, 3: propane explosive, 4: bee bomb, 5: bot player |
| cctv.camera_disable_seconds | конвар | 300 | |
| cctv.inputbudgetms | конвар | 0.05 | |
| ch47helicopteraicontroller.dropcrate | команда | — | Commands all active CH47 Chinook helicopter AI controllers to drop their cargo crate immediately |
| chat.cardgamesay | команда | — | |
| chat.clansay | команда | — | |
| chat.enabled | конвар | True | When enabled, this system is globally active; disable to deactivate the system for the current session |
| chat.globalchat | конвар | True | |
| chat.hidechatintutorial | конвар | True | |
| chat.historysize | конвар | 1000 | Number of messages to keep in memory for chat history |
| chat.localchat | конвар | False | |
| chat.localchatrange | конвар | 100 | Maximum distance in metres within which local chat messages are visible to nearby players; messages from beyond this range are not received |
| chat.localsay | команда | — | |
| chat.say | команда | — | |
| chat.search | команда | — | Search the console for a particular string |
| chat.serverlog | конвар | True | When enabled, all chat messages are written to the server log file in addition to being broadcast to players |
| chat.tail | команда | — | Return the last x lines of the console. Default is 200 |
| chat.teamsay | команда | — | |
| chicken.population | конвар | 3 | Population active on the server, per square km |
| cinematicentity.hideobjects | команда | — | Hides cinematic entities by group (0= none, 1= lights, 2= BGs, 3= props, 4= misc) |
| clan.addtoclan | команда | — | Adds a player by SteamID64 to your current clan |
| clan.disband | команда | — | Disbands your current clan |
| clan.editsrequireclantable | конвар | true | If enabled then players will need to be near a Clan Table to make changes to clans |
| clan.enabled | конвар | True | Enables the clan system if set to true (must be set at boot, requires restart) |
| clan.info | команда | — | Prints info about a clan given its ID or a steamID of a player in that clan |
| clan.maxmembercount | конвар | 100 | Maximum number of members each clan can have (local backend only!) |
| clan.scorefordestroyingbradley | конвар | 50 | How much score players earn for destroying bradley |
| clan.scorefordestroyingpatrolheli | конвар | 50 | How much score players earn for destroying patrol heli |
| clan.scoreforenablingwatertreatmentplant | конвар | 3 | How much score players earn for running the water treatment plant, per consumed item |
| clan.scoreforhackingcrates | конвар | 5 | How much score players earn for hacking crates |
| clan.scoreforinsertheavyfuseinpowerplant | конвар | 5 | How much score players earn for inserting a heavy fuse into powerplant |
| clan.scoreforlaunchingsatellite | конвар | 25 | How much score players earn for launching a satellite |
| clan.scoreforlootingelitecrate | конвар | 5 | How much score players earn for looting an elite crate |
| clan.scoreforlootingsatellite | конвар | 10 | How much score players earn for looting a crashed satellite's crates |
| clan.scoreforopeninghackedcrates | конвар | 10 | How much score players earn for opening hacked crates |
| clan.scoreforreachingcargoship | конвар | 10 | How much score players earn for reaching cargo ship |
| clan.scoreforrunningexcavator | конвар | 3 | How much score players earn for running the excavator, per diesel fuel consumed |
| clan.scoreforstartingoilrigfuelswitch | конвар | 5 | How much score players earn for starting the oil rig fuel switch |
| clan.scoreforswipingredkeycard | конвар | 5 | How much score players earn for swiping a red keycard |
| clan.scoretest | команда | — | Adds a generic score event to your clan |
| clawmarkspawner.showclawmarks | команда | — | |
| clothlod.clothloddist | конвар | 20 | distance cloth will simulate until |
| codelock.lockoutcooldown | конвар | 900 | Duration in seconds a player is locked out from attempting the code lock after exceeding maxFailedAttempts; default 900s (15 minutes) |
| codelock.maxfailedattempts | конвар | 8 | Maximum number of failed code entry attempts on a code lock before the player is locked out; default 8 |
| commandblock.commands_enabled | конвар | False | Can command blocks execute commands |
| commandblock.log_executions | конвар | True | Print a log message when a command block is executed |
| commandblock.use_player | конвар | False | If enabled, commands from command blocks will run using the last player who set them, allowing for a wider range of commands to be used |
| commands.echo | команда | — | |
| commands.find | команда | — | |
| communityentity.pietest | команда | — | |
| communityentity.pietest_next | команда | — | |
| communityentity.pietest_prev | команда | — | |
| console.consolehistorysize | конвар | 50 | Maximum number of console history entries |
| console.search | команда | — | Search the console for a particular string |
| console.tail | команда | — | Return the last x lines of the console. Default is 200 |
| construct.frameminutes | конвар | 30 | How many minutes before a placed frame gets destroyed |
| construction.alternativeloschecks_enabled | конвар | True | |
| convartimedprefabspawner.prefab_despawn_time | конвар | 20 | Time in seconds before spawned prefabs are despawned. Set to 0 to disable despawning. |
| convartimedprefabspawner.prefab_spawn_interval | конвар | 0 | Time in seconds between prefab spawns. Set to 0 to disable spawning. |
| convartimedprefabspawner.prefab_spawn_interval_variance | конвар | 3 | Variance in seconds to add/subtract from the spawn interval |
| convartimedprefabspawner.prefab_spawn_random_position_offset | конвар | 0 | Maximum random offset (sphere radius) from the spawner's position when spawning prefabs |
| convartimedprefabspawner.prefab_spawn_random_rotation | конвар | True | If true, spawned prefabs will have a random rotation |
| copypaste.copybox_sv | команда | — | Server-side handler that copies all entities within the specified bounding box (center + size) into a named paste file; called from copybox client command |
| copypaste.copybuilding_sv | команда | — | Server-side handler that copies all entities belonging to the building the player is looking at into a named paste file; called from the copybuilding client command |
| copypaste.copyradius_sv | команда | — | Server-side handler that copies all entities within the specified radius around a position into a named paste file; called from the copyradius client command |
| copypaste.download_paste_sv | команда | — | Downloads a paste file stored on the server (legacy server-side storage) by name and sends its entity data to the requesting client for local storage |
| copypaste.killbox_sv | команда | — | Server-side handler that destroys all entities within the current selection bounds that match the active paste filter options (NPCs, vehicles, deployables etc.) |
| copypaste.list_pastes_sv | команда | — | Lists all paste files stored in the legacy server-side copypaste directory and prints their names to the console |
| copypaste.printselection_sv | команда | — | Server-side handler that prints the names of all entities within the current selection bounds; used to preview what would be included in a copy operation |
| copypaste.undopaste_sv | команда | — | Undoes the most recent paste operation for the calling player by destroying all entities that were spawned in that paste; replies with 'History empty' if nothing to undo |
| countryphrases.debug_browser_codes | конвар | False | |
| coverpointvolume.cover_point_sample_step_height | конвар | 2 | cover_point_sample_step_height defines the height of the steps we do vertically for the cover point volume's cover point generation (smaller steps gives more accurate cover points, but at a higher processing cost). (default: 2.0) |
| coverpointvolume.cover_point_sample_step_size | конвар | 6 | cover_point_sample_step_size defines the size of the steps we do horizontally for the cover point volume's cover point generation (smaller steps gives more accurate cover points, but at a higher processing cost). (default: 6.0) |
| cow.population | конвар | 2 | Population active on the server, per square km |
| crabs.population | конвар | 2 | Population active on the server, per square km |
| craft.add | команда | — | |
| craft.cancel | команда | — | |
| craft.canceltask | команда | — | |
| craft.fasttracktask | команда | — | |
| craft.instant | конвар | — | When enabled, all crafting completes instantly with no time delay; useful for testing crafting recipes or quickly equipping items in development |
| creative.allusers | конвар | — | Apply creative mode to the entire server |
| creative.alwaysonenabled | конвар | — | Failsafe toggle that must be true before any alwaysOn commands work; prevents items from accidentally entering the always-on state outside of creative mode |
| creative.bypassholdtoplaceduration | конвар | — | Bypasses bypassHoldToPlaceDuration when deploying items |
| creative.freebuild | конвар | — | Build blocks for free |
| creative.freeplacement | конвар | — | Bypasses all placement checks |
| creative.freerepair | конвар | — | Bypass the 30s repair cooldown when repairing objects |
| creative.togglealwayson | команда | — | |
| creative.togglealwaysonall | команда | — | Sets the always-on state for all IAlwaysOn entities on the server (e.g. lights, switches); only works when alwaysOnEnabled is true and caller is in creative mode |
| creative.togglealwaysonradius | команда | — | |
| creative.togglecreativemodeuser | команда | — | Enables or disables creative mode for a specific player by name or Steam ID; creative mode removes resource costs and unlocks building freely |
| creative.unlimitedio | конвар | — | Bypasses limits on IO length and points |
| crocodile.population | конвар | 1 | Population active on the server, per square km |
| cui.cui_test | команда | — | |
| cui.cui_test_update | команда | — | |
| cui.endtest | команда | — | |
| dartsgame.accuracyadjustspeed | конвар | 1 | |
| dartsgame.accuratevelocitythreshold | конвар | 0.05 | |
| dartsgame.cooldownbetweenthrows | конвар | 3 | |
| dartsgame.debugcanplayagainstself | конвар | False | |
| dartsgame.holdfocusaddedfriction | конвар | 0.45 | |
| dartsgame.holdfocusduration | конвар | 2 | |
| dartsgame.idlekickseconds | конвар | 180 | |
| dartsgame.maxaccuracy | конвар | 0 | |
| dartsgame.maxthrowtimer | конвар | 10 | |
| dartsgame.maxzoom | конвар | 0.5 | |
| dartsgame.minaccuracy | конвар | 0.1 | |
| dartsgame.needdoubletowin | конвар | True | |
| dartsgame.reticlefriction | конвар | 0.5 | |
| dartsgame.reticleinputbufferapplication | конвар | 100 | |
| dartsgame.reticleinputspeed | конвар | 0.01 | |
| dartsgame.reticlemaxvelocity | конвар | 3 | |
| dartsgame.reticlerandomforcestrength | конвар | 0.5 | |
| dartsgame.reticlespawnpointradiusoffset | конвар | 0.5 | |
| dartsgame.scoretarget | конвар | 301 | Sets the score target in Darts. Standard games are either 301 or 501. |
| data.export | команда | — | Exports a named terrain map layer (splatmap, heightmap, biomemap, topologymap, alphamap, watermap) to a .raw file in the persistent data path |
| ddraw.ddrawother | команда | — | Sends a ddraw.text debug draw command to a specific player by Steam ID or name; allows admins to display debug text overlays on another player screen |
| debug.addmonumentblockergrace | команда | — | <minutes> (optional: <range>) - Adds the given number of minutes to the decay grace period timer of the monument blocker closest to you, making it start decaying that much sooner. Negative values rewind the timer |
| debug.applybuildingblockrandomisation | команда | — | Sets the visual variant index on the building block the calling player is looking at; useful for testing block randomisation visuals |
| debug.applypuzzleresettime | команда | — | Applies a debug reset time in seconds to all PuzzleReset objects in the scene, shortening their timers for rapid testing |
| debug.bag_respawn_parenting | конвар | True | Whether to parent players immediately on spawning to a boat if the bag is on a boat |
| debug.bench_io | команда | — | Spawn lots of IO entities to lag the server |
| debug.biofuel_stir_lock | конвар | False | Keeps players mounted on the biofuel generator after they let go of stir, until they dismount with jump |
| debug.breakheld | команда | — | Break the current held object |
| debug.breakheld_almost | команда | — | Almost break the current held object |
| debug.breakitem | команда | — | Break all the items in your inventory whose name match the passed string |
| debug.breakshield | команда | — | Breaks the currently held shield |
| debug.callbacks | конвар | False | When enabled, logs debug information about object callback invocations to the console; useful for tracing event callback chains |
| debug.checkparentingtriggers | конвар | True | When enabled, validates that trigger colliders are correctly parented to their entities during physics updates; helps catch mis-parenting bugs |
| debug.checktriggers | конвар | False | When enabled, validates trigger collider configurations each physics update to catch incorrectly parented or sized trigger volumes |
| debug.clearplayermodifiers | команда | — | Removes all active modifiers (buffs/debuffs) from the calling player; useful for resetting modifier state during testing |
| debug.cleartutorialforplayer | команда | — | If a player ends up stuck on a tutorial for any reason this will clear the island and reset the player (will also kill player) |
| debug.completemission | команда | — | Completes all incomplete objectives in the calling player active mission, triggering the mission completion flow |
| debug.completemissionstage | команда | — | Arg0: mission stage (int), Arg1: block objective resetting (bool, default false) |
| debug.completetutorial | команда | — | Immediately completes the calling player tutorial by triggering the island completion callback; bypasses normal progression |
| debug.console_print_color | команда | — | Prints a message to the server console using the specified ConsoleColor index; useful for testing coloured console output |
| debug.console_spam | команда | — | Logs a configurable number of test messages of a given length; used to stress-test console/logging performance and measure output speed |
| debug.conveyorstrictmodereport | команда | — | Prints the world position of every industrial conveyor running in strict mode; helps locate conveyors that are blocking item flow |
| debug.debugclippingchecks | конвар | False | Shows debug info for what objects are causing clipping checks to fail. |
| debug.debugdismountduration | конвар | 30 | Duration in seconds to keep ddraw for dismount attempts visible |
| debug.debugdismounts | конвар | False | Shows some debug info for dismount attempts. |
| debug.deleteentitiesbyshortname | команда | — | <shortname> (optional: <radius>) - Delete entities with the given short prefab name |
| debug.deleteentitybyid | команда | — | Delete entities by id. Supports multiple arguments |
| debug.disablecondition | конвар | False | Do not damage any items |
| debug.disablelootnavobstaclesindeepsea | конвар | True | When true, nav mesh obstacle components on loot containers are disabled in the deep sea zone to improve performance in underwater areas |
| debug.drink | команда | — | Adds a specified amount of hydration to the calling player at a configurable rate; useful for quickly testing thirst-related mechanics |
| debug.dropworlditems | команда | — | Drops a specified number of the given item short name as world entities from just in front of the calling player; useful for item physics testing |
| debug.eat | команда | — | Adds a specified amount of calories to the calling player at a configurable rate; useful for quickly testing hunger-related mechanics |
| debug.emptytankermodule | команда | — | emptyTankerModule - Clears the contents of the tanker module(s) of the modular car you're looking at |
| debug.enable_player_movement | команда | — | Sends a client RPC to the target player enabling or disabling their movement controls; admin only; useful for testing freeze/lock mechanics |
| debug.fillmounts | команда | — | fillmounts <radius> - Spawns and mounts a player on every mount point in radius |
| debug.filltankermodule | команда | — | fillTankerModule <item> - Fills the tanker module(s) of the modular car you're looking at with the given liquid (e.g. water, water.salt, crude.oil) |
| debug.findgap | команда | — | Find how large of a gap there is. <maxDistance> <stepsize> <maxSize> <layer> |
| debug.flushgroup | команда | — | Takes you in and out of your current network group, causing you to delete and then download all entities in your PVS again |
| debug.foodspoilingdeducttimehours | команда | — | Deducts the given number of hours from all spoilable food on the server |
| debug.foodspoilinginventoryhours | команда | — | Applies the given number of hours to all food in the players inventory |
| debug.foodspoilingspoilall | команда | — | Spoils all food on the server |
| debug.forcechickensspawnegg | команда | — | Forces all chickens within a given radius of the calling player to immediately spawn an egg; useful for testing egg drop and collection logic |
| debug.forcecrash | команда | — | Intentionally crash the process to verify the native crash handler. Optional category: accessviolation (default), fatalerror, abort, purevirtual, monoabort |
| debug.heal | команда | — | To disable revival if player is downed, pass in --no-recover as the first argument. |
| debug.hurt | команда | — | Deals a specified amount of bullet damage to the calling player; optionally targets a named bone to test per-bone hit reactions |
| debug.invis | команда | — | Make admin invisible |
| debug.log | конвар | — | When enabled, Unity Debug.Log output is written to disk; disabling first logs a final message before suppressing further output |
| debug.print_topologies | команда | — | Prints out the topologies at your position |
| debug.printgrouplayer | команда | — | Prints the network visibility layer (overworld, tunnel, underwater, etc.) at the calling player position; helps debug layer-based network group assignment |
| debug.printgroups | команда | — | Logs all server entity network group IDs and prefab names to the console; useful for debugging network visibility and group assignment |
| debug.printmissionspeakinfo | конвар | False | When enabled, logs mission NPC speech info (speaker, line, trigger) to the console as mission dialogue events fire |
| debug.printmonumentblocker | команда | — | Prints the health and decay state of the monument blocker closest to you. Optional argument: search range in metres (default 100) |
| debug.printqueues | команда | — | Prints a table of all ObjectWorkQueue instances showing name, total items processed, current queue length, and cumulative execution time |
| debug.puzzleprefabrespawn | команда | — | respawn all puzzles from their prefabs |
| debug.puzzlereset | команда | — | Reset all puzzles. Optionally provide a number to only reset puzzles within a radius. |
| debug.puzzleresetinfo | команда | — | Prints detailed debug info about the PuzzleReset the calling player is currently inside, including timer state and dependency status |
| debug.puzzleresettimemultiplier | конвар | 1 | Multiplier applied to all puzzle reset timers; values below 1.0 make puzzles reset faster, above 1.0 slower |
| debug.quittutorial | команда | — | |
| debug.refillvitals | команда | — | Refills the vital of a target player. eg. debug.refillsvital jim - leave blank to target yourself, can take multiple players at once. Will revive players if they are injured. To disable this, pass in --no-recover as the first argument. |
| debug.refillvitalsall | команда | — | Refills the vitals of all active players on the server. Will revive players if they are injured. To disable this, pass in --no-recover as the first argument. |
| debug.refrigeratedinventoryhours | команда | — | Adds the given number of refrigerated hours to all food in the players inventory, so things like milk skimming can be tested without waiting |
| debug.removeoverlappingstaticspawnpoints | команда | — | Scans all static respawn areas and kills any whose centre is within 1 metre of another, eliminating duplicate spawn points |
| debug.renderinfo | команда | — | Generates and logs a render info report showing draw calls, batch counts, triangle counts, and shadow caster counts for the current frame |
| debug.repair_inventory | команда | — | Repair all items in inventory |
| debug.resetsleepingbagtimers | команда | — | Resets all sleeping bag respawn cooldown timers for the calling player, allowing immediate re-use of all their bags |
| debug.respawnvinetreesinradius | команда | — | Respawns vine trees from their stumps within a given radius of the calling player; reports how many were respawned versus blocked by players |
| debug.setdamage | команда | — | Deals enough bullet damage to bring the calling player or a named target to the specified health value |
| debug.setfood | команда | — | Sets the calling player or a named target player calorie level to the specified value directly |
| debug.sethealth | команда | — | Sets the calling player or a named target player health to the specified value; useful for testing low-health or death scenarios |
| debug.setmaxhealth | команда | — | Overrides the maximum health of the calling player or a named target; pass 0 to reset to the default value |
| debug.setradiation | команда | — | Sets the calling player or a named target player radiation level to the specified value directly |
| debug.setthrowable | команда | — | 0 = can't throw, 1 = can throw & melee, 2 = only throwable |
| debug.setunloadablecarfillpercent | команда | — | Sets the ore fill percentage on all unloadable train cars within 3 metres of the calling player; updates both inventory amounts and visual ore level |
| debug.setwater | команда | — | Sets the calling player or a named target player hydration level to the specified value directly |
| debug.spawn_all_deployables | команда | — | Spawns one of every deployable in a grid |
| debug.spawnovenstresstest | команда | — | Spawns a 100x10 grid of lit furnaces loaded with wood and metal ore near the calling player; used to stress-test the oven cooking system |
| debug.spawnparachutetester | команда | — | Spawns a clone of the calling player at a configurable height with a parachute deployed and their belt and wear inventories copied |
| debug.stall | команда | — | Stalls the main thread for the given duration in seconds (clamped 0-1); admin-only; used to test timeout handling and watchdog systems |
| debug.starttutorial | команда | — | |
| debug.test_custom_vitals | команда | — | Sends a configurable number of test custom vital entries to the calling player client for a given duration; used to verify custom vitals UI rendering |
| debug.testerror | команда | — | Logs a test error and exception for testing error display. |
| debug.testtutorialcinematic | команда | — | Triggers the tutorial island ending cinematic for the calling player; spawns a kayak at the designated mount point and mounts the player to it |
| debug.tutorial_start_cooldown | конвар | 60 | Minimum seconds that must pass after a tutorial ends before another one can start; prevents back-to-back tutorial spam |
| debug.tutorialstatus | команда | — | Prints a table of all active tutorial islands showing index, network group ID, assigned player name, duration, and connection state |
| debug.vineswinginghighlight | команда | — | Sends a highlight RPC to every VineMountable on the server targeting the calling player; used for visually debugging vine placement |
| debug.vineswingingreport | команда | — | Prints a summary table of all VineSwingingTree and VineMountable entities on the server, including average destination count per mountable |
| decay.addfakeauthhistory | команда | — | addfakeauthhistory <count>, adds fake deauthed players to the auth history of the tool cupboard you are standing in, for testing group upkeep tiers |
| decay.bracket_0_blockcount | конвар | 15 | Number of blocks in the 1st upkeep bracket |
| decay.bracket_0_costfraction | конвар | 0.1 | Blocks in the 1st upkeep bracket will cost this value per day to maintain |
| decay.bracket_0_doorcount | конвар | 15 | Number of doors in the 1st upkeep bracket |
| decay.bracket_0_doorfraction | конвар | 0.1 | Doors in the 1st upkeep bracket will cost this value per day to maintain |
| decay.bracket_1_blockcount | конвар | 50 | Number of blocks in the 2nd upkeep bracket |
| decay.bracket_1_costfraction | конвар | 0.15 | Blocks in the 2nd upkeep bracket will cost this value per day to maintain |
| decay.bracket_1_doorcount | конвар | 50 | Number of doors in the 2nd upkeep bracket |
| decay.bracket_1_doorfraction | конвар | 0.15 | Doors in the 2nd upkeep bracket will cost this value per day to maintain |
| decay.bracket_2_blockcount | конвар | 125 | The number of blocks in the 3rd upkeep bracket |
| decay.bracket_2_costfraction | конвар | 0.2 | Blocks in the 3rd upkeep bracket will cost this value per day to maintain |
| decay.bracket_2_doorcount | конвар | 125 | The number of doors in the 3rd upkeep bracket |
| decay.bracket_2_doorfraction | конвар | 0.2 | Doors in the 3rd upkeep bracket will cost this value per day to maintain |
| decay.bracket_3_costfraction | конвар | 0.333 | Blocks in the 4th upkeep bracket will cost this value per day to maintain |
| decay.bracket_3_doorfraction | конвар | 0.333 | Doors in the 4th upkeep bracket will cost this value per day to maintain |
| decay.build_twig_cost_multiplier | конвар | 1 | Can players upgrade building blocks to wood |
| decay.clearauthhistory | команда | — | Clears the deauthed player history on the tool cupboard you are standing in, dropping its group upkeep back to the number of authed players |
| decay.debug | конвар | False | When enabled, logs decay tick details to the console including which entities took damage and how much |
| decay.delay_metal | конвар | 0 | How long should this building grade decay be delayed when not protected by upkeep, in hours |
| decay.delay_override | конвар | 0 | When set to a value above 0 everything will decay with this delay |
| decay.delay_stone | конвар | 0 | How long should this building grade decay be delayed when not protected by upkeep, in hours |
| decay.delay_toptier | конвар | 0 | How long should this building grade decay be delayed when not protected by upkeep, in hours |
| decay.delay_twig | конвар | 0 | How long should this building grade decay be delayed when not protected by upkeep, in hours |
| decay.delay_wood | конвар | 0 | How long should this building grade decay be delayed when not protected by upkeep, in hours |
| decay.drawnearbybuildings | команда | — | drawnearbybuildings <duration> <radius>, shows building ID of entities |
| decay.duration_metal | конвар | 8 | How long should this building grade take to decay when not protected by upkeep, in hours |
| decay.duration_override | конвар | 0 | When set to a value above 0 everything will decay with this duration |
| decay.duration_stone | конвар | 5 | How long should this building grade take to decay when not protected by upkeep, in hours |
| decay.duration_toptier | конвар | 12 | How long should this building grade take to decay when not protected by upkeep, in hours |
| decay.duration_twig | конвар | 1 | How long should this building grade take to decay when not protected by upkeep, in hours |
| decay.duration_wood | конвар | 3 | How long should this building grade take to decay when not protected by upkeep, in hours |
| decay.forcedecaytick | команда | — | Call the decay tick on every single entity on the server (for testing decay works) |
| decay.high_wall_upkeep | конвар | 0.2 | Upkeep scale for external walls and gates |
| decay.outside_test_range | конвар | 50 | Maximum distance to test to see if a structure is outside, higher values are slower but accurate for huge buildings |
| decay.scale | конвар | 1 | Multiplier applied to all decay damage per tick; 1.0 = normal, 2.0 = double decay rate, 0.0 = no decay |
| decay.tick | конвар | 600 | Interval in seconds between decay processing ticks; default is 10 minutes; lower values cause buildings to lose health more frequently |
| decay.upgrade_hqm_cost_multiplier | конвар | 1 | Can players upgrade building blocks to hqm |
| decay.upgrade_hqm_enabled | конвар | True | Can players upgrade building blocks to hqm |
| decay.upgrade_metal_cost_multiplier | конвар | 1 | Can players upgrade building blocks to metal |
| decay.upgrade_metal_enabled | конвар | True | Can players upgrade building blocks to metal |
| decay.upgrade_stone_cost_multiplier | конвар | 1 | Can players upgrade building blocks to stone |
| decay.upgrade_stone_enabled | конвар | True | Can players upgrade building blocks to stone |
| decay.upgrade_wood_cost_multiplier | конвар | 1 | Can players upgrade building blocks to wood |
| decay.upgrade_wood_enabled | конвар | True | Can players upgrade building blocks to wood |
| decay.upkeep | конвар | True | Is upkeep enabled |
| decay.upkeep_grief_protection | конвар | 1440 | How many minutes can the upkeep cost last after the cupboard was destroyed? default : 1440 (24 hours) |
| decay.upkeep_group_count_locks | конвар | True | Should players holding a code on one of the building's doors count towards the group size, whether it is the master code or the guest code |
| decay.upkeep_group_history_max | конвар | 256 | Maximum number of players a tool cupboard remembers in the group window, oldest are dropped first |
| decay.upkeep_group_max_multiplier | конвар | 3 | Upper limit on the group size upkeep multiplier |
| decay.upkeep_group_scaling | конвар | True | Should upkeep cost scale with the number of players authed on the tool cupboard |
| decay.upkeep_group_tier_0_increase | конвар | 0 | Each player in the 1st upkeep group tier increases upkeep cost by this fraction |
| decay.upkeep_group_tier_0_playercount | конвар | 4 | Number of players in the 1st (free) upkeep group tier |
| decay.upkeep_group_tier_1_increase | конвар | 0.02 | Each player in the 2nd upkeep group tier increases upkeep cost by this fraction |
| decay.upkeep_group_tier_1_playercount | конвар | 6 | Number of players in the 2nd (small group) upkeep group tier |
| decay.upkeep_group_tier_2_increase | конвар | 0.04 | Each player in the 3rd (large group) upkeep group tier increases upkeep cost by this fraction, this tier is unlimited |
| decay.upkeep_group_window_hours | конвар | 24 | Players who authed within this many hours still count towards the group size, even if they have since deauthed |
| decay.upkeep_heal_scale | конвар | 1 | Scale at which objects heal when upkeep conditions are met, default of 1 is same rate at which they decay |
| decay.upkeep_inside_decay_scale | конвар | 0.1 | Scale at which objects decay when they are inside, default of 0.1 |
| decay.upkeep_lock_min_users | конвар | 2 | If a code lock has <= this number of users it won't count its users towards group upkeep tax |
| decay.upkeep_period_minutes | конвар | 1440 | How many minutes does the upkeep cost last? default : 1440 (24 hours) |
| decay.use_door_upkeep_brackets | конвар | False | Should doors have their own upkeep brackets separate from building blocks |
| decayentity.debuggetprivilege | конвар | False | When enabled, logs detailed debug output for building privilege (tool cupboard auth) checks during decay calculations |
| decayentity.demolish_seconds | конвар | 600 | Time window in seconds after placement during which a player can demolish their own building block; default 600s (10 minutes) |
| deepsea.allow_all_vehicles | конвар | False | Allow all vehicles to travel to the deep sea, instead of just the whitelisted vehicles |
| deepsea.allow_swimmers | конвар | False | Allow players to swim to the deep sea |
| deepsea.block_building | конвар | True | |
| deepsea.close | команда | — | Initiates the deep sea closing sequence |
| deepsea.createdeepsea | команда | — | Creates the deep sea manager entity on the server |
| deepsea.debug_portal_spawnattempts | конвар | False | When enabled, logs each deep sea portal spawn attempt to the console including whether it succeeded or failed |
| deepsea.enabled | конвар | True | Toggles the deep sea. Needs a server restart to take effect. Any saved deep sea entities will be destroyed at the next startup |
| deepsea.enterdeepsea | команда | — | Teleports the player (or their mounted vehicle) into the deep sea |
| deepsea.entities_spawninterval | конвар | 5 | When generating, the interval in seconds in between each entity spawn (island, ghost ship and floating city). Increase if you're experiencing lag when the deep sea is opening. |
| deepsea.floatingcity_count | конвар | 1 | Number of floating cities to spawn in the deep sea |
| deepsea.floatingcity_edgemargin | конвар | 1500 | Minimum distance in metres floating cities must be from the deep sea boundary edge when spawning |
| deepsea.floatingcity_mindist | конвар | 1500 | Minimum distance in metres required between floating city |
| deepsea.floatingcity_radius | конвар | 500 | Exclusion radius in metres around floating cities |
| deepsea.forceentranceportaldirection | конвар | 0 | 0 Random, 1 North, 2 East, 3 South, 4 West |
| deepsea.ghostship_count | конвар | 4 | Number of ghost ship to spawn in the deep sea zone |
| deepsea.ghostship_edgemargin | конвар | 450 | Minimum distance in metres ghost ships must be from the deep sea boundary edge when spawning |
| deepsea.ghostship_mindist | конвар | 400 | Minimum distance in metres required between ghost ships |
| deepsea.ghostship_radius | конвар | 80 | Exclusion radius in metres around ghost ship |
| deepsea.hackablecrate_count | конвар | 1 | Number of hackable crates to spawn in the deep sea |
| deepsea.island_count | конвар | 6 | Number of islands to spawn in the deep sea zone |
| deepsea.island_edgemargin | конвар | 750 | Minimum distance in metres islands must be from the deep sea boundary edge when spawning |
| deepsea.island_mindist | конвар | 600 | Minimum distance in metres required between islands |
| deepsea.island_portal_terrain_distance | конвар | 750 | Distance in metres from the main island shore at which deep sea entrance portals are placed |
| deepsea.island_radius | конвар | 300 | Exclusion radius in metres around islands |
| deepsea.islands_billboard_scale | конвар | 1 | Scale multiplier for the deep sea island billboards |
| deepsea.leavedeepsea | команда | — | Teleports the player (or their mounted vehicle) back to the main island from the deep sea. |
| deepsea.logs | конвар | False | When enabled, outputs verbose deep sea system log messages (portal transitions, wipe events, entity moves) to the server log for debugging |
| deepsea.loot_respawn_scale | конвар | 1 | Population multiplier applied to the loot the deep sea will respawn over time. 1.0 = unchanged, 0.5 = half, 2.0 = double |
| deepsea.loot_scale | конвар | 1 | Population multiplier applied to the loot the deep sea spawns with. 1.0 = unchanged, 0.5 = half, 2.0 = double |
| deepsea.mainisland_billboard_scale | конвар | 1 | Scale multiplier for the main island billboard seen from the deep sea |
| deepsea.navmesh_spawninterval | конвар | 5 | When generating, the interval in seconds in between each island navmesh bake. Increase if you're experiencing lag when the deep sea is opening. |
| deepsea.open | команда | — | Initiates the deep sea opening sequence |
| deepsea.openonserverwipe | конвар | False | Should the deep sea open as soon as the server wiped? |
| deepsea.printboatteleports | команда | — | Prints what players on the player's boat will be teleported to the deep sea |
| deepsea.printentitycount | команда | — | Prints a breakdown of all entities currently in the deep sea |
| deepsea.printloot | команда | — | Prints a breakdown of all loot containers, trees, and ore nodes currently in the deep sea |
| deepsea.printtimetowipe | команда | — | Prints the current time remaining until the deep sea wipes |
| deepsea.rhib_count | конвар | 4 | Number of RHIB boat groups to spawn in the deep sea |
| deepsea.rhib_edgemargin | конвар | 1150 | Minimum distance in metres RHIB groups must be from the deep sea boundary edge when spawning |
| deepsea.rhib_mindist | конвар | 300 | Minimum distance in metres required between RHIB groups |
| deepsea.rhib_radius | конвар | 10 | Exclusion radius in metres around each RHIB group |
| deepsea.settimetonextopening | команда | — | Sets the time in seconds until the deep sea re-opens after a wipe |
| deepsea.settimetowipe | команда | — | Sets the time in seconds until the deep sea wipe triggers |
| deepsea.spawnfloatingcityhere | команда | — | Spawns a random floating city prefab at the player position |
| deepsea.spawnghostshiphere | команда | — | Spawns a random ghost ship prefab at the player position |
| deepsea.spawngroups_spawninterval | конвар | 0.15 | When generating, the interval in seconds in between each spawn groups fill (dwellings/crates/scientists on island, ghost ships). Increase if you're experiencing lag when the deep sea is opening. |
| deepsea.spawnislandhere | команда | — | Spawns a random deep sea island prefab at the player position |
| deepsea.spawnrhibgrouphere | команда | — | Spawns a RHIB patrol boat group at the player position |
| deepsea.status | команда | — | Prints the current deep sea status |
| deepsea.stricttransitionreposition | конвар | True | Ensure all players on a mounted boat are repositioned after a transition, if this is false we rely on parenting exclusively |
| deepsea.terrain_everywhere | конвар | False | Applies the deep sea terrain config and foliage to the whole map, not just inside the deep sea |
| deepsea.testportalspawnlocation | команда | — | Tests whether the calling player's current position is a valid portal spawn location; draws a green sphere if valid or red sphere if invalid with the given radius and duration in seconds |
| deepsea.wipecooldownmax | конвар | 5400 | Maximum seconds before a deep sea re-opens after closing |
| deepsea.wipecooldownmin | конвар | 5400 | Minimum seconds before a deep sea re-opens after closing |
| deepsea.wipeduration | конвар | 10800 | Duration in seconds of the deep sea wipe |
| deepsea.wipeendphaseduration | конвар | 1800 | Duration in seconds of the final wipe phase, bad weather kicking in etc |
| deepsea.wiperadiationphaseduration | конвар | 300 | Seconds before radiation starts to ramp in before the deep sea wipe |
| demo.compatibilitylayer | конвар | False | Enable demo compatibility layer to resolve renamed/moved prefabs from older recordings |
| demo.record | команда | — | Starts recording a server-side demo for the specified player by name or Steam ID to a timestamped file; the player must be connected |
| demo.recordlist | конвар | | Comma-separated list of player Steam IDs whose demos are automatically recorded on the server; empty means no targeted recording |
| demo.recordlistmode | конвар | 0 | Controls the behavior of recordlist, 0=whitelist, 1=blacklist |
| demo.splitmegabytes | конвар | 200 | Maximum file size in megabytes before a demo recording is automatically split; prevents individual demo files from becoming unmanageably large |
| demo.splitseconds | конвар | 3600 | Maximum duration in seconds before a demo recording is automatically split into a new file; default is 3600 (1 hour) |
| demo.stop | команда | — | Stops the active server-side demo recording for the specified player and finalises the demo file |
| doorstress.audit | команда | — | Audit every pasted base for door gating anomalies: doorstress.audit |
| doorstress.auditresults | команда | — | Print the last audit results |
| doorstress.bench | команда | — | Run the fixed door gating suite over the pasted corpus: doorstress.bench <burst reps, default 3> <leaf slabs 1 or 0, default 1>. Non destructive, every door is restored to the state it was in |
| doorstress.benchresults | команда | — | Print the last benchmark results |
| doorstress.build_env | команда | — | Paste the bigbaseRF corpus on the ground and bake it: doorstress.build_env <centerX centerZ>, defaults -140 140 |
| doorstress.clear | команда | — | Kill the pasted corpus and rebake the ground it stood on |
| doorstress.envreport | команда | — | Print the last corpus build report |
| doorstress.featurebench | команда | — | Price the whole door gating feature per event class, gates on vs off: doorstress.featurebench <door placement samples, default 24> |
| doorstress.featureresults | команда | — | Print the last feature bench results |
| doorstress.finalbench | команда | — | Final door gating comparison over every pasted base: doorstress.finalbench <reps, default 3> |
| doorstress.finalresults | команда | — | Print the last final bench results |
| doorstress.proposalbench | команда | — | Price the no-slabs + thin-aperture + no-ownership proposal against shipped, step by step: doorstress.proposalbench <reps, default 3> |
| doorstress.proposalresults | команда | — | Print the last proposal bench results |
| doorstress.pruneresults | команда | — | Print the last prune sweep results |
| doorstress.prunesweep | команда | — | Rebake the pasted base at a range of minRegionSizeMeters and census doors and polys at each: doorstress.prunesweep |
| doorstress.sweepresults | команда | — | Print the last thickness sweep results |
| doorstress.thicknesssweep | команда | — | Rebake the corpus at a range of aperture half thicknesses and census the door to door overlap at each: doorstress.thicknesssweep |
| drone.altitudespeedoverride | конвар | 0 | If greater than zero, overrides the drone's vertical movement speed |
| drone.disablesamtargeting | конвар | — | |
| drone.maxcontrolrange | конвар | 600 | How far drones can be flown away from the controlling computer station |
| drone.movementspeedoverride | конвар | 0 | If greater than zero, overrides the drone's planar movement speed |
| drone.samproximityfuseradius | конвар | 10 | Radius at which a SAM missile's proximity fuse detonates against drones, capped by the missile's 20m trigger sphere |
| drone.windlerpspeed | конвар | 0.1 | |
| drone.windpositiondivisor | конвар | 100 | |
| drone.windpositionscale | конвар | 1 | |
| drone.windrotationmultiplier | конвар | 45 | |
| drone.windtimedivisor | конвар | 10 | |
| droppeditem.broadcast_debug_ddraw | конвар | False | Will broadcast debug ddraw information on ALL dropped items to ALL players |
| droppeditem.remove_rb_on_sleep | конвар | False | Whether Rigidbody components are removed from DroppedItems when sleeping |
| droppeditem.underwater_drag_budget_ms | конвар | 0.05 | How many milliseconds to spend on updating underwater drag levels |
| dungeonnavmesh.use_baked_terrain_mesh | конвар | True | |
| dynamicnavmesh.use_baked_terrain_mesh | конвар | — | |
| egghuntevent.includebots | конвар | False | Will spawn eggs for bots, only for debug purposes - don't enable it! |
| electricbattery.batteryid | команда | — | |
| electricbattery.dischargebudgetms | конвар | 0.05 | |
| entity.countby | команда | — | Count all entities created by provided users (separate users by space) |
| entity.debug_toggle | команда | — | Toggles the debug info overlay for an entity by net ID, showing position, velocity, health, and network state in the world |
| entity.deleteby | команда | — | Destroy all entities created by provided users (separate users by space) |
| entity.deletebytextblock | команда | — | Destroy all entities created by users in the provided text block (can use with copied results from ent auth) |
| entity.find_entity | команда | — | Lists all networked entities whose prefab path contains the given filter string in a formatted table; admin-only on client |
| entity.find_group | команда | — | Lists all networked entities belonging to the given network group ID in a formatted table; admin-only on client |
| entity.find_id | команда | — | Lists the networked entity with the given network entity ID in a formatted table; admin-only on client |
| entity.find_parent | команда | — | Lists all networked entities that have the given network entity ID as their parent in a formatted table; admin-only on client |
| entity.find_radius | команда | — | Lists all networked entities within the given radius in metres of the calling player in a formatted table; admin-only on client |
| entity.find_self | команда | — | Lists all networked entities owned by the calling player (matched by network ID) in a formatted table; admin-only on client |
| entity.find_status | команда | — | Lists all networked entities whose status string contains the given filter text in a formatted table; admin-only on client |
| entity.nudge | команда | — | Applies a small positional nudge to an entity by net ID, useful for unsticking entities that are clipping into geometry |
| entity.set_battery_charge | команда | — | Sets the charge level of an electric battery entity by net ID to the given percentage (0-100) |
| entity.spawn | команда | — | Spawns a server entity by prefab name at a given world position and direction; returns the spawned entity net ID |
| entity.spawngrid | команда | — | Spawns a grid of server entities by prefab name centred at a position; useful for stress-testing entity counts |
| entity.spawnitem | команда | — | Spawns a dropped item entity server-side by item short name at a given world position |
| entity.spawnlootfrom | команда | — | Spawns a copy of the loot table from one container prefab into the world at the calling player position |
| entity.spawnplants | команда | — | Spawn every stage of every plant inside it's own planter, with an optional filter |
| entity.spawnvendor | команда | — | Spawns a complete NPC vendor by vendor name - both the shopkeeper NPC and the invisible vending machine it needs - at the position the calling player is looking at |
| entity.test_pooling | команда | — | Editor only: stress-tests the entity pool system by rapidly spawning and despawning a named prefab many times |
| env.addtime | команда | — | Advances the in-game time of day by the specified number of hours; useful for quickly cycling to day or night for testing |
| env.day | конвар | — | Gets or sets the current in-game day of the month; used for calendar-driven events and date display |
| env.daylength | конвар | — | How many real minutes one in-game day lasts on the server. Not sent to clients, whose sky keeps its own day length between time syncs, so lower it headless or in the editor to run a day through quickly. Never zero, freeze time with env.progresstime instead |
| env.month | конвар | — | Gets or sets the current in-game month (1-12); used for seasonal event triggers and calendar display |
| env.nightlight_brightness | конвар | 0.008 | |
| env.nightlight_debugcamera_enabled | конвар | 0 | Toggles nightlight screen effect when using debug camera |
| env.nightlight_distance | конвар | 5 | |
| env.nightlight_enabled | конвар | 1 | When enabled, ambient night lighting is applied at night; disabling makes nights pitch-black for horror or specific event scenarios |
| env.nightlight_fadefraction | конвар | 0.65 | |
| env.oceanlevel | конвар | 0 | |
| env.progresstime | конвар | — | When enabled, the server advances the in-game time of day automatically; disabling freezes time at its current value |
| env.redmoon | конвар | 0 | |
| env.time | конвар | — | Gets or sets the current in-game time of day as a decimal hour (0.0-24.0); writing a value immediately jumps the time to that point |
| env.year | конвар | — | Gets or sets the current in-game year; used for date display and long-running server event tracking |
| espcanvas.colourcodeteams | конвар | False | Admin-only: when enabled, ESP player info elements are coloured by team membership using the configured team colour IDs |
| espcanvas.disableocclusionchecks | конвар | False | Admin-only: when enabled, occlusion checks are skipped for ESP player info elements so they are always visible regardless of walls |
| espcanvas.maxnameplates | конвар | 32 | Max amount of nameplates to show at once |
| espcanvas.nameplateautosize | конвар | — | Admin-only: Should the nameplates size dynamically change based on distance? |
| espcanvas.nameplateautosize_falloff | конвар | 50 | Admin-only: Nameplate falloff distance for autosizing (smaller values cause the text to shrink at closer distances). |
| espcanvas.overridemaxdisplaydistance | конвар | 0 | Admin-only: overrides the maximum distance at which ESP player info elements are shown; 0 = use default distance |
| espcanvas.showhealth | конвар | False | Admin-only: when enabled, player health values are shown in ESP player info elements above each player |
| espcanvas.showvoip | конвар | False | Admin-only: when enabled, an icon will be displayed as part of ESP player info elements for each player that is currently communicating over in-game voice chat |
| espcanvas.userandomteamcolours | конвар | False | Admin-only: when enabled, ESP player info team colours are randomised per team rather than using the configured team ID colour mapping |
| events.print_server_events | команда | — | Prints a table of all registered server events with their current enabled state, minimum delay, maximum delay, and last trigger time |
| events.set_event_enabled | команда | — | Enables or disables a specific server event by name; disabled events will not trigger automatically until re-enabled |
| events.set_event_max_delay | команда | — | Sets the maximum delay in seconds between automatic triggers of the named server event |
| events.set_event_min_delay | команда | — | Sets the minimum delay in seconds between automatic triggers of the named server event |
| eventschedule.killallevents | команда | — | Kills all currently running triggered event instances across all enabled event schedules; registered as eventschedule.killallevents |
| eventschedule.triggerevent | команда | — | Triggers a named event schedule by partial name match; registered as eventschedule.triggerevent; lists available events if name is invalid or ambiguous |
| eventschedulewipeoffset.event_hours_before_wipe | конвар | 24 | Number of real-time hours before a scheduled wipe at which the pre-wipe event schedule begins running; registered as event_hours_before_wipe |
| excavatorsignalcomputer.automaticchargeneededforsupplies | конвар | 600 | Amount of charge required for the excavator to automatically trigger supply drop delivery without player activation |
| excavatorsignalcomputer.chargeneededforsupplies | конвар | 600 | Amount of charge (in seconds of operation) the excavator signal computer requires before it can manually call a supply drop |
| farmableanimal.simhours | команда | — | Simulates the provided number of hours on all farm animals within 10m |
| file.debug | конвар | — | Enables verbose debug logging for the file system abstraction layer, logging all file read/write operations to the console |
| file.time | конвар | — | When enabled, measures and logs the time taken for each file system operation, helping identify slow asset or config file loading |
| fishing.debugoverfishing | конвар | False | |
| fishing.disableoverfishing | конвар | False | |
| fishing.overfishedareadurationminutes | конвар | 30 | |
| fishing.overfishedarearadius | конвар | 16 | |
| fishing.successesuntiloverfished | конвар | 25 | |
| fps.graph | конвар | — | Controls the FPS graph overlay mode; 0 = off, higher values show increasingly detailed frame time graphs and performance metrics |
| fps.limit | конвар | 240 | Target application frame rate cap; 0 = unlimited; on client clamped to 240; on server limits tick dispatch rate; saved between sessions |
| frankensteinbrain.movetowardsrate | конвар | 1 | |
| frankensteinpet.decayminutes | конвар | 180 | How long before a Frankenstein Pet dies un controlled and not asleep on table |
| frog.population | конвар | 2 | Population active on the server, per square km |
| fuzzysearch.search_similarity_modifier | конвар | 0.14 | How similar the server name must be to the search filter to be included in the results. (0 is exact match, 1 is no match at all) |
| gamemode.set | команда | — | Sets the active game mode by name; game modes can alter loot tables, rules, and player abilities (e.g. softcore, hardcore) |
| gamemode.setteam | команда | — | |
| gamemodesoftcore.allow_tc_corpse_no_building | конвар | True | |
| gamemodesoftcore.gather_rate | конвар | 2 | Global multiplier for resources gathered in Softcore mode from ores, trees, logs, wild plants and animals; 1.0 = default, 2.0 = double yield |
| gamemodesoftcore.reclaim_building_auth | конвар | False | When enabled, items are kept in a reclaim backpack even if the player died while inside their own authorised base |
| gamemodesoftcore.reclaim_fraction_belt | конвар | 0.5 | Fraction of belt slot items that are preserved in a softcore death reclaim backpack; default 0.5 (50%) |
| gamemodesoftcore.reclaim_fraction_main | конвар | 0.5 | Fraction of main inventory items preserved in a softcore death reclaim backpack; default 0.5 (50%) |
| gamemodesoftcore.reclaim_fraction_wear | конвар | 1 | Fraction of clothing/armour items that are preserved in a softcore death reclaim backpack; default 1.0 (100%) |
| gamemodesoftcore.reclaim_suicide | конвар | False | When enabled, items are kept in a reclaim backpack even if the player died by suicide (F1 kill) |
| gamephysics.defaultmaxresultsperquery | конвар | 48 | How many results to collect per command - DONT set this too low or you'll risk missing results |
| gc.alloc | команда | — | Allocates a byte array of the given size (default 1 MB) as a GC pressure test; useful for profiling memory allocation throughput |
| gc.buffer | конвар | — | Raw size in bytes of the GC buffer allocation; do not set directly — use gc.buffer_enabled and let the system manage allocation |
| gc.buffer_enabled | конвар | True | Enables the managed memory GC buffer, which pre-allocates a buffer to delay GC collections and reduce GC-induced frame hitches |
| gc.collect | команда | — | Triggers an immediate full managed garbage collection pass; useful after large allocations for memory profiling |
| gc.debuglevel | конвар | 1 | Controls the verbosity of GC debug output; higher values print more details about collection frequency and memory pressure |
| gc.enabled | конвар | — | When enabled, this system is globally active; disable to deactivate the system for the current session |
| gc.incremental_enabled | конвар | — | Read-only: reports whether Unity incremental garbage collection is enabled for this runtime; cannot be changed at runtime |
| gc.incremental_milliseconds | конвар | — | Time slice in milliseconds allocated to incremental GC per frame; lower values reduce GC stutter but spread collection over more frames |
| gc.unload | команда | — | Calls Resources.UnloadUnusedAssets() to unload assets no longer referenced by any object, freeing RAM and VRAM |
| global.add_wallpaper_radius | команда | — | <name/id> <radius> | Use print_wallpaper_skins for a list | 0 -> default, -1 -> random |
| global.adminui_deleteugccontent | команда | — | Clears all UGC content (images, patterns) from the entity with the given network ID and notifies the IUGCBrowserEntity component |
| global.adminui_fullrefresh | команда | — | Triggers a full refresh of the admin UI by requesting the player list, server info, convars, and UGC list all at once |
| global.adminui_requestfireworkpattern | команда | — | Sends the firework pattern design data for the specified pattern firework entity to the requesting admin client |
| global.adminui_requestplayerlist | команда | — | Server-side handler that serialises and sends the current player list to the requesting admin client for display in the admin UI |
| global.adminui_requestserverconvars | команда | — | Server-side handler that collects all ServerAdmin+ShowInAdminUI convars and sends them to the admin client for editing via the admin UI |
| global.adminui_requestserverinfo | команда | — | Server-side handler that serialises and sends current server info (name, players, FPS, etc.) to the requesting admin client |
| global.adminui_requestugccontent | команда | — | Server-side handler that retrieves a specific UGC data blob by CRC, entity ID, and type and sends it to the requesting admin client |
| global.adminui_requestugclist | команда | — | Server-side handler that scans all entities for UGC content (images, patterns, vending names) and sends a serialised list to the admin client |
| global.allowadminui | конвар | True | Controls whether the in-game admin UI is displayed to admins |
| global.applygenes | команда | — | <gene string> - Applies the given genes (e.g. "YYYGGG") to the clone/seed in your hands |
| global.authcount | команда | — | Returns all entities that the provided player is authed to (TC's, locks, etc), supports --json |
| global.authradius | команда | — | Authorises the specified player (or caller if none given) to all tool cupboards within the given radius around them |
| global.authradius_multi | команда | — | Authorises multiple specified players to all tool cupboards within the given radius around the calling admin |
| global.authradius_radius | команда | — | Finds all players within playerRadius of the caller, then authorises each of them to TCs within authRadius of themselves |
| global.ban | команда | — | ban <player> <reason> [optional duration] |
| global.banid | команда | — | banid <steamid> <username> <reason> [optional duration] |
| global.banlist | команда | — | List of banned users (sourceds compat) |
| global.banlistex | команда | — | List of banned users - shows reasons and usernames |
| global.bans | команда | — | List of banned users |
| global.blockemoji | конвар | False | Blocks any emoji from appearing |
| global.blockemojianimations | конвар | False | Disables any emoji animations |
| global.blockserveremoji | конвар | False | Blocks emoji provided by servers from appearing |
| global.breakclothing | команда | — | Breaks all equipped clothing items currently worn by the calling player, reducing their condition to zero |
| global.breakitem | команда | — | Reduces the condition of all items in the calling player inventory whose short name matches the given string to zero, breaking them |
| global.buildinfo | команда | — | Get information about this build |
| global.carstats | команда | — | Get information about all the cars in the world |
| global.change_wallpaper_radius | команда | — | <name/id> <radius> | Use print_wallpaper_skins for a list | 0 -> default, -1 -> random |
| global.cinematicgingerbreadcorpses | конвар | False | When enabled a player wearing a gingerbread suit will gib like the gingerbread NPC's |
| global.clear_wallpaper_radius | команда | — | clear_wallpaper_radius <radius> |
| global.clearallsprays | команда | — | Removes all spray paint entities from the server world; useful for cleaning up excessive player spray art |
| global.clearallspraysbyplayer | команда | — | Removes all spray paint entities created by a specific player, identified by Steam ID or name |
| global.clearcontainer | команда | — | clearcontainer: Removes all items inside the container you're looking at |
| global.clearcontainer_radius | команда | — | clearcontainer_radius <radius>: Removes all items inside a container within a radius |
| global.cleardroppeditems | команда | — | Removes all dropped item entities from the server, cleaning up every piece of loot on the ground |
| global.clearspraysatpositioninradius | команда | — | Removes all spray paint entities within a given radius of the specified world position (X Y Z) |
| global.clearspraysinradius | команда | — | Removes all spray paint entities within the given radius of the calling admin current position |
| global.clearugcbyplayer | команда | — | Clears UGC content from all entities that have the specified player (by name or Steam ID) in their editing history |
| global.clearugcentitiesinrange | команда | — | Clears UGC content from all entities within the given radius of a world position; reports how many entities were cleared |
| global.clearugcentity | команда | — | Clears all UGC content from a single entity by network ID; reports success or failure |
| global.clearvendingmachinenamescontaining | команда | — | Clears the custom name UGC from all vending machines whose content string contains the given search text (case/symbol insensitive) |
| global.clientperf | команда | — | Requests a performance report from every connected client; supports legacy and JSON formats; used for monitoring client frame rates and memory usage |
| global.colliders | команда | — | Prints the count of enabled versus disabled Collider components currently in the scene |
| global.deauthradius | команда | — | Removes authorisation for the specified player (or caller) from all tool cupboards within the given radius |
| global.deauthradius_multi | команда | — | Removes authorisation for multiple specified players from all tool cupboards within the given radius around the calling admin |
| global.deauthradius_radius | команда | — | Finds all players within playerRadius of the caller, then deauthorises each of them from TCs within authRadius of themselves |
| global.developer | конвар | — | Developer mode level: 0 = off, 1 = developer overlays and convar unlocks, higher values enable increasingly verbose debug logging |
| global.disablebagdropping | конвар | False | Disables the backpacks that appear after a corpse times out |
| global.dump | команда | — | Dumps a diagnostic snapshot into a folder in /diagnostics/. WARNING: this will stall the server and can cause it to crash. |
| global.dumpanimators | команда | — | Dumps a diagnostic snapshot of animators into a diagnostics subfolder |
| global.dumpentities | команда | — | Dumps a diagnostic snapshot of entities into a diagnostics subfolder |
| global.dumplodgroups | команда | — | Dumps a diagnostic snapshot of LOD Groups into a diagnostics subfolder |
| global.dumpnetwork | команда | — | Dumps a diagnostic snapshot of network info into a diagnostics subfolder |
| global.dumpobjects | команда | — | Dumps a diagnostic snapshot of objects into a diagnostics subfolder |
| global.dumpphysics | команда | — | Dumps a diagnostic snapshot of physics into a diagnostics subfolder |
| global.dumppreprocess | команда | — | Dump list of prefabs pre-processed into a diagnostics subfolder |
| global.dumprootobjects | команда | — | Dumps a diagnostic snapshot of root objects (all gameobjects across all scenes) into a /diagnostics/ subfolder. WARNING: this will stall the server and can cause it to crash. |
| global.dumpsysteminformation | команда | — | Dumps a diagnostic snapshot of system information into a diagnostics subfolder |
| global.dumpwarmup | команда | — | Dumps a diagnostic snapshot of warmup info into a diagnostics subfolder |
| global.entcount | команда | — | Returns all entities that the provided player has placed, supports --json |
| global.entid | команда | — | Runs an admin command (kill, lock, unlock, etc.) on a specific entity by network ID; blocks operation on players and point entities |
| global.fillcontainer | команда | — | fillcontainer <optional: category> - Fills the container you are looking at with random items, can also specify a category (ammunition, weapon etc.) |
| global.fillcontainer_radius | команда | — | fillcontainer_radius <radius> <optional: category> - Fills containers with random items within a radius, can also specify a category |
| global.fillinventory | команда | — | fillinventory <optional: category> - Fills your inventory with random items, can also specify a category (ammunition, weapon etc.) |
| global.forceoffadminstatusoverlay | конвар | False | Media: Forcefully disables all status overlays (god, creative, invis) |
| global.forceunloadbundles | конвар | True | When enabled, asset bundles are unloaded from memory after their assets are extracted, saving memory; disable to keep bundles resident |
| global.free | команда | — | Clears prefab pools and releases pooled objects; delegates to pool.clear_prefabs; admin/developer only |
| global.getugcinfo | команда | — | Returns a JSON object containing the UGC info (CRCs, type, player history) for the entity with the given network ID |
| global.god | конвар | False | If you're an admin this will enable god mode |
| global.injure | команда | — | Puts the calling player or a named target into the wounded/downed state, simulating the critical injury bleed-out state |
| global.injureplayer | команда | — | Puts the specified player into the wounded/downed state immediately without killing them; useful for testing the crawl/revive mechanics |
| global.job_system_threads | конвар | — | Number of Unity job worker threads; 0 or -1 sets the default (auto); higher values improve parallel job throughput on many-core CPUs |
| global.kick | команда | — | Kicks the specified player from the server with an optional reason; broadcasts the kick to chat and places them through the queue on reconnect |
| global.kickall | команда | — | Kicks all currently connected players from the server with an optional reason; useful for forcing a restart or clearing the server |
| global.kill | команда | — | |
| global.killallplayers | команда | — | Deals lethal damage to every non-NPC player currently connected to the server; reports the number of players killed |
| global.killbees | команда | — | Kills all bee swarms |
| global.killplayer | команда | — | Deals 1000 damage to the specified player (by name/SteamID/bot) killing them immediately; useful for testing death logic without console kill commands |
| global.listid | команда | — | List of banned users, by ID (sourceds compat) |
| global.maxspraysperplayer | конвар | 40 | If a player sprays more than this, the oldest spray will be destroyed. 0 will disable |
| global.maxthreads | конвар | 8 | Maximum number of Unity job system worker threads; controls the background thread pool size for job dispatching |
| global.moderatorid | команда | — | Adds the specified Steam64 ID as a server moderator with optional name and reason; grants admin flag to the player if connected |
| global.mute | команда | — | Mutes the specified connected player preventing them from using chat; optionally accepts a mute expiry timestamp for temporary mutes |
| global.mutelist | команда | — | Print a list of currently muted players |
| global.objects | команда | — | Prints all live Unity Object instances sorted by total memory usage, showing type, instance count, and estimated total size in bytes |
| global.ownerid | команда | — | Adds the specified Steam64 ID as a server owner (auth level 2) with optional name and reason; requires the caller to also be auth level 2 |
| global.perf | конвар | 0 | Controls the on-screen performance overlay detail level; 0 = off, higher values add more metrics such as FPS, ping, entity count, and memory usage |
| global.perf_disable_gc_notif | конвар | False | Media: This can be used to disable the performance text info when GC gets triggered |
| global.playerlist | команда | — | Get a list of players |
| global.playerlistids | команда | — | Get a list of player's IDs |
| global.players | команда | — | Print out currently connected clients etc |
| global.print_wallpaper_skins | команда | — | Lists all wallpaper skins |
| global.printallscenesinbuild | команда | — | Prints all scenes registered in the build settings with their build index and asset path |
| global.queue | команда | — | Prints the current state of server-side stability check and surroundings update queues; reports nothing useful on client |
| global.quit | команда | — | Quits the application cleanly with no arguments; rejects calls with arguments to prevent accidental exit; in the editor exits play mode |
| global.recover | команда | — | Revives the calling player or a named target from the wounded state, restoring them to standing with a small amount of health |
| global.recoverplayer | команда | — | Recovers the specified player from the wounded state, standing them back up at minimum health |
| global.removemoderator | команда | — | Removes moderator status from the specified Steam64 ID; removes admin flag from the player if currently connected |
| global.removeowner | команда | — | Removes owner status from the specified Steam64 ID; removes admin flag from the player if currently connected |
| global.removeskipqueue | команда | — | Removes skip queue permission from a SteamID |
| global.report | команда | — | Runs a server performance diagnostic report covering entity counts, memory usage, and active invokes, outputting results to the server console |
| global.respawn | команда | — | |
| global.respawn_sleepingbag | команда | — | |
| global.respawn_sleepingbag_favourite | команда | — | |
| global.respawn_sleepingbag_remove | команда | — | |
| global.restart | команда | — | Schedules a server restart; optionally accepts a countdown in seconds and a broadcast message sent to all players before the restart occurs |
| global.say | команда | — | Sends a message in chat |
| global.serverinfo | команда | — | Get a list of information about the server |
| global.setinfo | команда | — | |
| global.showbotsinplayerlist | конвар | False | Include bots in the admin UI player list (debugging purpose only) |
| global.showemojierrors | конвар | False | Displays any emoji rendering errors in the console |
| global.skick | команда | — | Silently kicks the specified player without broadcasting to chat; the kick is logged to RCON only |
| global.skin_looking | команда | — | <skin> |
| global.skin_radius | команда | — | skin_radius 'skin' 'radius' |
| global.skipqueue | команда | — | Moves the specified Steam64 ID to the front of the connection queue so they connect immediately on next join |
| global.skipqueueid | команда | — | Adds skip queue permissions to a SteamID |
| global.sleep | команда | — | Puts the calling player into the sleeping state, disconnecting their control and making them a sleeping entity on the server |
| global.sleepingusers | команда | — | Show user info for players on server. |
| global.sleepingusersinrange | команда | — | Show user info for sleeping players on server in range of the player. |
| global.sleeptarget | команда | — | Puts the player that the calling admin is looking at into the sleeping state; useful for testing sleeping player interactions |
| global.spectate | команда | — | Enters spectator mode; optionally accepts a player name or Steam ID to spectate that specific player from a third-person camera |
| global.spectateid | команда | — | Enters spectator mode targeting the entity or player with the given network entity ID |
| global.sprayduration | конвар | 10800 | Base time (in seconds) that sprays last |
| global.sprayoutofauthmultiplier | конвар | 0.5 | Multiplier applied to SprayDuration if a spray isn't in the sprayers auth (cannot go above 1f) |
| global.stats | команда | — | Print out stats of currently connected clients |
| global.status | команда | — | Print out currently connected clients |
| global.status_cl | команда | — | Prints client-side connection status information including connected state, ping, player entity ID, and current map to the client console |
| global.status_sv | команда | — | |
| global.steamconnectiontimeout | конвар | — | |
| global.steamnagleflush | конвар | — | |
| global.steamnagletime | конвар | — | Nagle time, in microseconds |
| global.steamnetdebug | конвар | — | Turns on varying levels of debug output for the Steam Networking. This will affect performance. (0 = off, 1 = bug, 2 = error, 3 = important, 4 = warning, 5 = message, 6 = verbose, 7 = debug, 8 = everything) |
| global.steamnetdebug_ackrtt | конвар | — | |
| global.steamnetdebug_message | конвар | — | |
| global.steamnetdebug_p2prendezvous | конвар | — | |
| global.steamnetdebug_packetdecode | конвар | — | |
| global.steamnetdebug_packetgaps | конвар | — | |
| global.steamnetdebug_sdrrelaypings | конвар | — | |
| global.steamrelayinit | команда | — | |
| global.steamsendbuffer | конвар | — | Upper limit of buffered pending bytes to be sent |
| global.steamsendratemax | конвар | — | Maxminum send rate clamp, 0 is no limit |
| global.steamsendratemin | конвар | — | Minimum send rate clamp, 0 is no limit |
| global.steamstatus | команда | — | |
| global.subscriptions | команда | — | Prints a table of active network group subscriptions for the calling player, showing realm and group ID; supports --json flag |
| global.sysinfo | команда | — | Prints a summary of the current machine hardware and OS info including CPU, GPU, RAM, and platform |
| global.sysuid | команда | — | Prints the unique device identifier for the current machine as reported by Unity SystemInfo.deviceUniqueIdentifier |
| global.teaminfo | команда | — | Prints a table of all members in the team of the specified player showing Steam ID, username, online status, and whether they are team leader; supports --json |
| global.teleport | команда | — | Teleports the calling admin to a player by name or partial name match; if two arguments are given, moves the first-named player to the second |
| global.teleport2autheditem | команда | — | <steamID/name> <optional: filter> - Teleport to a random entity the player is authed on |
| global.teleport2death | команда | — | Teleports the calling admin to their own most recent death location |
| global.teleport2entityid | команда | — | Teleport to the entity with the specified network ID |
| global.teleport2grid | команда | — | Teleports the calling admin to the centre of the named map grid square (e.g. A1, B3) |
| global.teleport2marker | команда | — | Teleports the calling admin to the map marker they have placed on their in-game map |
| global.teleport2me | команда | — | Teleports the named player to the calling admin current position |
| global.teleport2mission | команда | — | Teleports the calling admin to the target location of their currently active mission objective |
| global.teleport2nearest | команда | — | Teleport to the current closest entity matching the first argument name. Add second int argument to teleport to the nth closest entity (teleport2nearest horse 2 will teleport to the 3rd closest horse) |
| global.teleport2owneditem | команда | — | Teleports the calling admin to an entity owned by a specified player, identified by Steam ID or name |
| global.teleport2satellitecrashsite | команда | — | Teleports the calling admin to the currently locked-in satellite crash site. Does nothing if no satellite is descending. |
| global.teleportany | команда | — | Teleports the calling admin to the nearest entity matching the given prefab short name, with an optional radius filter |
| global.teleportboat2grid | команда | — | Teleports the calling admin and their player boat to the centre of the named map grid square (e.g. A1, B3) |
| global.teleportboat2marker | команда | — | Teleports the calling admin and their player boat to the map marker they have placed on their in-game map |
| global.teleportboatpos | команда | — | Teleports the calling admin and their player boat to exact world coordinates specified as X Y Z arguments |
| global.teleporteveryone2me | команда | — | Teleports all connected players to the calling admin current position |
| global.teleportlos | команда | — | Teleports the calling admin to the point in the world that their line of sight is currently hitting |
| global.teleportnonsleepers2me | команда | — | Teleports all connected active (non-sleeping) players to the calling admin current position |
| global.teleportpos | команда | — | Teleports the calling admin or a named player to exact world coordinates specified as X Y Z arguments |
| global.teleportsleepers2me | команда | — | Teleports all sleeping player entities to the calling admin current position |
| global.teleporttargetteam2me | команда | — | Teleports all members of the named player team to the calling admin current position |
| global.teleportteam2me | команда | — | Teleports all members of the calling player team to the calling admin current position |
| global.textures | команда | — | Prints a list of all live Texture objects with their name and estimated runtime memory size |
| global.togglespectateteaminfo | команда | — | Toggles display of the team info overlay (health, location, vitals) for the spectated player while in spectator mode |
| global.unban | команда | — | Removes the ban for the specified Steam64 ID from the server banlist, allowing the player to reconnect |
| global.unlockradius | команда | — | Clears the lock flag on every code lock and key lock within a radius of the calling player, so a base can be walked without its codes. Radius defaults to 20 metres |
| global.unmute | команда | — | Removes the chat mute from the specified connected player, allowing them to send messages again |
| global.updatemanifest | команда | — | Immediately update the manifest |
| global.updatenetworkpositionwithdebugcamerawhilespectating | конвар | False | When true, the server network position is updated to match the debug camera world position while spectating; useful for testing position-dependent server logic from the spectator view |
| global.upgrade_looking | команда | — | <grade> |
| global.upgrade_radius | команда | — | upgrade_radius 'grade' 'radius' |
| global.users | команда | — | Show user info for players on server. |
| global.usersinrange | команда | — | Show user info for players on server in range of the player. |
| global.usersinrangeofplayer | команда | — | Show user info for players on server in range of the supplied player (eg. Jim 50) |
| global.version | команда | — | Prints the current game version string to the console, including build number and branch |
| graphics.af | конвар | 1 | Anisotropic filtering level 1-16; higher values improve texture sharpness at oblique angles at a minor GPU cost; 1 = disabled |
| graphics.branding | конвар | True | When enabled, shows the Facepunch/Rust branding watermark on screen |
| graphics.chat | конвар | True | When enabled, the chat window is displayed; also gated by global.canChat |
| graphics.compass | конвар | 1 | Compass display mode: 0 = hidden, 1 = always visible, 2 = visible whilst Compass keybind is held, 3 = visible when Compass keybind is toggled |
| graphics.contactshadows | конвар | False | When enabled, renders screen-space contact shadows to add fine-detail shadows at object contact points not covered by shadow maps |
| graphics.detailed_postprocessing_profiling | конвар | False | When enabled, outputs detailed per-pass profiling data for the post-processing stack to the profiler; useful for identifying expensive post-processing passes |
| graphics.dof | конвар | False | When enabled, activates the depth-of-field post-processing effect, blurring objects outside the focal distance |
| graphics.dof_aper | конвар | 12 | Depth-of-field aperture (f-stop); lower values produce a shallower depth of field with more background blur |
| graphics.dof_barrel | конвар | 0 | Admin/cinematic: barrel distortion amount applied to the depth-of-field effect |
| graphics.dof_blur | конвар | 1 | Depth-of-field blur intensity multiplier; higher values produce a stronger blur on out-of-focus areas |
| graphics.dof_debug | конвар | False | Admin/cinematic: when enabled, draws a debug overlay showing the depth buffer and circle of confusion for DoF tuning |
| graphics.dof_focus_dist | конвар | 10 | distance from camera to focus on |
| graphics.dof_focus_target | команда | — | Sets a player or entity as the live depth-of-field focus target by name/entity ID; the DoF focus distance tracks the target while set |
| graphics.dof_focus_time | конвар | 0.2 | Time in seconds for the depth-of-field focus distance to lerp to a new target when auto or dynamic mode is active |
| graphics.dof_kernel_count | конвар | 0 | Goes from 0 - 3, higher = more dof samples but slower perf |
| graphics.dof_mode | конвар | 0 | 0 = auto 1 = manual 2 = dynamic based on target |
| graphics.dof_nudge | команда | — | Adjusts the current manual depth-of-field focus distance by the given amount in metres; negative values bring focus closer |
| graphics.dof_squeeze | конвар | 0 | Admin/cinematic: anamorphic squeeze factor applied to DoF bokeh shapes; 0 = circular, positive values = oval/anamorphic |
| graphics.drawdistance | конвар | 2500 | Maximum camera draw distance in metres; objects beyond this distance are culled; lower values improve GPU performance at the cost of view distance |
| graphics.fov | конвар | — | Camera field of view in degrees, clamped between 70 and 90; higher values provide a wider view but can cause edge distortion |
| graphics.grassshadowsenabled | конвар | False | Developer-only: when enabled, grass geometry casts shadows; disabled by default due to performance cost on GPU shadow rendering |
| graphics.hud | конвар | True | When enabled, the in-game HUD is visible; disable to hide all HUD elements (health bar, hotbar, etc.) for screenshots |
| graphics.itemskins | конвар | — | When enabled, Steam Workshop skins are applied to items; disable to revert all items to default appearance |
| graphics.itemskintimeout | конвар | — | Timeout in seconds before a workshop skin download is considered failed and abandoned |
| graphics.itemskinunload | конвар | — | When enabled, unreferenced workshop skin assets are unloaded from memory after the unload delay elapses |
| graphics.itemskinunloaddelay | конвар | — | The time in seconds before a unreferenced skin is unloaded. |
| graphics.lodbias | конвар | — | Global multiplier for the LOD's switching distance. A larger value leads to a longer view distance before a lower resolution LOD is picked. |
| graphics.parallax | конвар | 0 | Terrain parallax mapping mode: 0 = off, 1 = parallax offset, 2 = parallax occlusion; higher modes improve terrain depth at GPU cost |
| graphics.shadowfilterquality | конвар | 1 | Developer-only: shadow PCF filtering quality 0-3; higher values use more shadow map samples for softer edges; also updates shadowmode and shader keywords |
| graphics.shadowlights | конвар | 1 | Maximum number of lights that can cast real-time shadows simultaneously; clamped to a minimum of 1; higher values improve shadow coverage at GPU cost |
| graphics.shadowmode | конвар | 2 | Shadow quality mode: 1 = hard, 2 = soft (PCF), 3 = high quality (PCSS), 4 = very high quality; higher modes are more expensive |
| graphics.uiscale | конвар | 1 | UI scale multiplier clamped between 0.5 and 1.0; lower values shrink all UI elements to fit more on screen |
| graphics.vm_fov_scale | конвар | True | Whether to scale vm models with fov |
| graphics.vm_horizontal_flip | конвар | False | FLips viewmodels horizontally (for left handed players) |
| graphics.vsync | конвар | — | Represents the number of vertical syncs that should pass between each frame. An integer in the range of 0-4. |
| graphicssettings.anisotropicfiltering | конвар | — | Global anisotropic filtering mode. 0-2. Disabled, enabled per-texture, force-enabled for all textures. |
| graphicssettings.billboardsfacecameraposition | конвар | — | If enabled, billboards will face towards camera position rather than camera orientation. |
| graphicssettings.enablelodcrossfade | конвар | — | Enables or disables LOD Cross Fade. |
| graphicssettings.globaltexturemipmaplimit | конвар | — | Indicates how many of the highest-resolution mips of each texture Unity does not upload at the given quality level. |
| graphicssettings.numshadowcascades | конвар | — | Number of cascades to use for directional light shadows. 1 = None, 2 = Two, 4 = Four |
| graphicssettings.particleraycastbudget | конвар | — | Budget for how many ray casts can be performed per frame for approximate collision testing. |
| graphicssettings.pixellightcount | конвар | — | The maximum number of pixel lights that should affect any object. |
| graphicssettings.shadowdistance | конвар | — | Shadow drawing distance |
| graphicssettings.shadowmapresolution | конвар | — | The default resolution of shadow maps. 0 = Low, 1 = Medium, 2 = High, 3 = Very High |
| graphicssettings.shadowqualitypreset | конвар | 3 | The preset that determines all shadow settings. Low for performance, Max for the best visuals. |
| graphicssettings.softparticles | конвар | — | Should soft blending be used for particles? |
| growableentity.framebudgetms | конвар | 0.25 | How many miliseconds to budget for processing growable quality updates per frame |
| growableentity.growall | команда | — | Server admin: forces all growable entities within 6m of the calling player to advance to their next growth stage instantly |
| growableentity.killall | команда | — | Server admin: kills all growable entities within 6m of the calling player, removing them from the planter |
| guntrap.gun_trap_budget_ms | конвар | 0.5 | How many milliseconds to spend on target scanning per frame |
| hackablelockedcrate.decayseconds | конвар | 7200 | How many seconds until the crate is destroyed without any hack attempts |
| hackablelockedcrate.requiredhackseconds | конвар | 900 | How many seconds for the crate to unlock |
| halloween.enabled | конвар | True | Enables the Halloween event on the server, activating Halloween-themed loot spawns, NPC variants, and event-specific mechanics |
| halloween.murdererpopulation | конвар | 0 | Population active on the server, per square km |
| halloween.scarecrow_beancan_vs_player_dmg_modifier | конвар | 0.1 | Modified damage from beancan explosion vs players (Default: 0.1). |
| halloween.scarecrow_body_dmg_modifier | конвар | 0.25 | Modifier to how much damage scarecrows take to the body. (Default: 0.25) |
| halloween.scarecrow_chase_stopping_distance | конвар | 0.5 | Stopping distance for destinations set while chasing a target (Default: 0.5) |
| halloween.scarecrow_throw_beancan_global_delay | конвар | 8 | The delay globally on a server between each time a scarecrow throws a beancan (Default: 8 seconds). |
| halloween.scarecrowpopulation | конвар | 2 | Population active on the server, per square km |
| halloween.scarecrows_throw_beancans | конвар | True | Scarecrows can throw beancans (Default: true). |
| halloweendungeon.lifetime | конвар | 600 | How long each active dungeon should last before dying |
| halloweendungeon.population | конвар | 1 | Population active on the server |
| handcuffs.maxconditionrepairlossonpush | конвар | 0.4 | Maximum handcuff condition loss fraction applied per push attempt; at 0.4 the cuffs lose up to 40% condition per escape push |
| handcuffs.restrainedpushdamage | конвар | 5 | Damage dealt to a restrained (handcuffed) player when they attempt to push or escape; default 5 |
| handcuffs.togglecuffslocked | команда | — | Toggles the locked state of the handcuffs held by the calling admin player, switching between locked and unlocked |
| harmony.load | команда | — | Loads and applies a Harmony patch assembly by file name, enabling server-side code patching without restarting |
| harmony.unload | команда | — | Unloads a previously loaded Harmony patch assembly by file name, reverting any code modifications it applied |
| hbhfsensor.debugdraw | конвар | — | When enabled, broadcasts debug drawing for HBHFSensor visibility checks (eye position, forward, range, per-player LOS rays). |
| heli.bulletaccuracy | конвар | 2 | Cone angle in degrees of the patrol helicopter gun spread; higher values make the helicopter less accurate |
| heli.bulletdamagescale | конвар | 1 | Multiplier applied to all bullet damage dealt by the patrol helicopter; 1.0 = normal, 2.0 = double damage |
| heli.call | команда | — | Spawns and sends a patrol helicopter to the specified player or position, using the same logic as calltome but targeting another player |
| heli.calltome | команда | — | Orders the active patrol helicopter to fly to the calling admin position and attack there |
| heli.death | команда | — | Forces the active patrol helicopter to die immediately, triggering its death explosion and crash sequence |
| heli.drop | команда | — | Spawns a patrol helicopter at the calling admin position, bypassing the normal random spawn logic; primarily used for testing |
| heli.flee | команда | — | Orders the active patrol helicopter to immediately flee to a random distant location and disengage |
| heli.guns | конвар | 1 | Number of gun hardpoints active on the patrol helicopter; set to 0 to disable its guns without despawning it |
| heli.lifetimeminutes | конвар | 30 | How many minutes the patrol helicopter stays airborne before self-destructing; default is 30 minutes |
| heli.move | команда | — | Moves the active patrol helicopter to the calling admin current position without entering combat mode |
| heli.orbit | команда | — | Orders the active patrol helicopter to orbit around the calling admin current position |
| heli.orbitstrafe | команда | — | Orders the active patrol helicopter to orbit and strafe the calling admin position simultaneously |
| heli.patrol | команда | — | Orders the active patrol helicopter to resume normal patrol mode, following its randomised waypoint path across the map |
| heli.strafe | команда | — | Orders the active patrol helicopter to perform a strafing run on the calling admin current position |
| heli.testpuzzle | команда | — | Triggers the helicopter puzzle sequence (approach, puzzle activation, reward) for testing the helicopter monument puzzle |
| hexagongridgenerator.generategrid | команда | — | <gridSize> 5 <tileSpacing> 1.35 |
| hierarchy.cd | команда | — | Changes the current hierarchy context to the named child GameObject, similar to the Unix cd command; allows drilling into nested scene objects |
| hierarchy.del | команда | — | Deletes the named GameObject from the scene hierarchy; use with caution as this permanently removes the object |
| hierarchy.ls | команда | — | Lists all GameObjects in the current hierarchy context, similar to the Unix ls command; used for navigating the scene hierarchy from the console |
| hotairballoon.minimumaltitudeterrain | конвар | 25 | |
| hotairballoon.outsidedecayminutes | конвар | 180 | How long before a HAB loses all its health while outside |
| hotairballoon.population | конвар | 1 | Population active on the server |
| hotairballoon.serviceceiling | конвар | 175 | |
| inventory.addownership | команда | — | Add ownership to item |
| inventory.clearinventory | команда | — | Clears the inventory of a target player. eg. inventory.clearInventory jim. Can take container names as arguments: --belt --wear --backpack |
| inventory.convertownership | команда | — | Reduce ownership to item to allow new ownership to be added |
| inventory.copyto | команда | — | Copies the players inventory to the player in front of them |
| inventory.defs | команда | — | Prints the names of all Steam inventory item definitions currently loaded from the Steam backend; useful for verifying skin/item definition state |
| inventory.deleteloadout | команда | — | Deletes a named admin loadout file from the server; requires admin or developer permissions; loadout name is passed as the first argument |
| inventory.deployloadout | команда | — | Deploys the given loadout to a target player. eg. inventory.deployLoadout testloadout jim |
| inventory.deployloadoutinrange | команда | — | Deploys a loadout to players in a radius eg. inventory.deployLoadoutInRange testloadout 30 |
| inventory.disableattirelimitations | конвар | — | Disables all attire limitations, so NPC clothing and invalid overlaps can be equipped |
| inventory.endloot | команда | — | |
| inventory.equipslot | команда | — | Equips the belt/hotbar item at the given slot index for the calling admin or a named target player; requires admin or developer permissions |
| inventory.equipslottarget | команда | — | Equips the belt/hotbar slot at the given index for the player the admin is currently looking at; requires admin or developer permissions |
| inventory.give | команда | — | {item} {amount} {condition} {skin} {container} {slot} |
| inventory.giveall | команда | — | Gives the specified item (by partial name) to every currently connected player on the server; broadcasts who issued the command in chat |
| inventory.givearm | команда | — | {itemid} {amount} |
| inventory.givebp | команда | — | Gives the calling player a blueprint item for the specified item (by partial name); broadcasts the gift in chat unless the recipient is a developer |
| inventory.giveequip | команда | — | {item} |
| inventory.giveid | команда | — | {itemid} {amount} |
| inventory.giveto | команда | — | {item} {player} {amount} {skin} |
| inventory.lighttoggle | команда | — | |
| inventory.listloadouts | команда | — | Prints all saved inventory loadouts |
| inventory.loadoutui_requestloadoutlist | команда | — | Reads the list of saved admin loadouts from disk and sends it to the requesting player's client as a JSON array for display in the loadout UI |
| inventory.pipetteid | команда | — | Checks whether the calling player has the specified item ID with the given skin ID in their inventory; used to validate pipette/skin matching server-side |
| inventory.reduceownership | команда | — | Reduce ownership to item to allow new ownership to be added |
| inventory.reloaddefs | команда | — | Forces a reload of all Steam inventory item definitions from the Steam backend; use if definitions appear stale or missing after a store update |
| inventory.resetbp | команда | — | Resets all blueprints for the specified player (by name/Steam ID) back to the default unlocked set, removing any learned recipes |
| inventory.saveloadout | команда | — | Saves the current equipped loadout of the calling player. eg. inventory.saveLoadout loaduoutname |
| inventory.set_item_image | команда | — | Sets the custom icon image ID on the item currently held by the calling player; the image ID refers to a server-side stored image used for custom item icons |
| inventory.setwornarmorslots | команда | — | Set worn items to have maximum armor slots supported |
| inventory.stackable_item_ownership | конвар | — | When enabled, ownership tracking is applied to stackable items; disabled by default due to performance cost; servers can enable for full ownership auditing |
| inventory.unlockall | команда | — | Unlocks every craftable blueprint for the specified player (by name/Steam ID), giving them access to all recipes immediately |
| ioentity.allow_on_boats | конвар | True | Allows the deployment and usage of IO entities on player boats and tugboats. |
| ioentity.backtracking | конвар | 8 | Number of IO update passes allowed to back-track and re-process changed entities each tick; higher values improve signal propagation speed |
| ioentity.debugbudget | конвар | False | Print out what is taking so long in the IO frame budget |
| ioentity.debugbudgetthreshold | конвар | 2 | Ignore frames with a lower ms than this while debugBudget is active |
| ioentity.debugqueue | команда | — | Prints the current state of all IO entity processing queues showing queue type and pending entity counts; admin-only |
| ioentity.framebudgetelectrichighpriorityms | конвар | 1 | How many milliseconds to budget for processing high priority electric io entities per server frame (monuments) |
| ioentity.framebudgetelectriclowpriorityms | конвар | 0.5 | How many milliseconds to budget for processing low priority io entities per server frame (player placed) |
| ioentity.framebudgetfluidms | конвар | 0.25 | How many milliseconds to budget for processing fluid io entities per server frame |
| ioentity.framebudgetgenericms | конвар | 1 | How many milliseconds to budget for processing generic io entities per server frame (unused for now) |
| ioentity.framebudgetindustrialms | конвар | 0.25 | How many milliseconds to budget for processing industrial entities per server frame |
| ioentity.framebudgetkineticms | конвар | 1 | How many milliseconds to budget for processing kinetic io entities per server frame (monuments) |
| ioentity.infiniteiopower | конвар | False | All player placed electrical entities will receive full power without needing to be plugged into anything |
| ioentity.responsetime | конвар | 0.1 | Minimum interval in seconds between IO entity logic updates; controls how quickly electrical signals propagate through the network |
| itemmanager.enablepooling | конвар | True | When enabled, ItemManager uses object pooling for item instances to reduce GC allocations from frequent item creation and destruction |
| jellyfish.population | конвар | 2 | Population active on the server, per square km |
| junkpile.destroyifspawnonsleepingbag | конвар | True | |
| junkpile.destroyifspawnonsleepingbagdistance | конвар | 3 | |
| junkpile.destroyifspawnonsleepingbagtime | конвар | 4 | |
| junkpilewater.destroyablebyplayerboats | конвар | True | |
| junkpilewater.framebudgetms | конвар | 0.05 | How many milliseconds to budget for processing junk pile updates per frame |
| junkpilewater.minimumplayerboatmasstobedestroyed | конвар | 2000 | |
| junkpilewater.minimumplayerboatvelocitytobedestroyed | конвар | 5 | |
| legacyshelter.max_shelters | конвар | 1 | |
| livestock.agescale | конвар | 1 | Multiplier applied to livestock grow and old-age times; 0.5 = grow up twice as fast, 0 = disable aging entirely |
| livestock.ageup | команда | — | Immediately ages up the nearest livestock animal: an infant grows into its next stage, an adult dies of old age. Optional search radius in metres (default 20). |
| livestock.allowmounting | конвар | True | Whether livestock can be mounted into vehicle flatbeds |
| livestock.baselinenameweight | конвар | 5 | How many notional players livestock.namelocale counts as when the languages of everyone connected are weighed up, so one player alone does not name the whole herd |
| livestock.breedcooldown | конвар | 600 | How long (in seconds) a male livestock animal waits before breeding again, counted from conception. The female's is derived from how long her calf takes to grow up |
| livestock.breedingenabled | конвар | True | Whether livestock look for a mate on their own; disabling it leaves livestock.makepregnant working |
| livestock.breedonlyathome | конвар | False | Whether livestock breed only while a cupboard is their home |
| livestock.breedpausecondition | конвар | 0.6 | Condition at or below which a livestock animal stops being willing to breed |
| livestock.breedresumecondition | конвар | 0.7 | Condition at or above which a livestock animal that stopped breeding is willing again |
| livestock.breedsearchradius | конвар | 30 | How far (in metres) a male livestock animal looks for a mate |
| livestock.calmedtrustfloor | конвар | 60 | The seconds a livestock animal credits to a player under a livestock handling effect; kept inside the tolerated band on purpose |
| livestock.calvingcooldownscale | конвар | 1 | Scales how long a mother waits after calving before she can carry again. 1 is one calf grown up per birth |
| livestock.census | команда | — | Counts the livestock population and what it has produced. Optional radius in metres around the caller (default 0, the whole map). |
| livestock.censusreset | команда | — | Zeroes the livestock census running totals and the profiler, so the next reading covers only what happens from now. |
| livestock.cleargrazing | команда | — | Grows back every overgrazed patch of grass near the caller, and clears what the herd has eaten there. Optional radius in metres (default 100). |
| livestock.completepregnancy | команда | — | Makes the nearest pregnant livestock animal give birth now, without waiting out the rest of its pregnancy. Optional search radius in metres (default 20). |
| livestock.conditionfallseconds | конвар | 3600 | How many seconds a totally neglected livestock animal takes to go from full health to dead |
| livestock.conditionfullcontentment | конвар | 0.5 | Contentment at or above which a livestock animal is healthy and heals towards full |
| livestock.conditionriseseconds | конвар | 3600 | How many seconds a well kept livestock animal takes to heal from nothing back to full health |
| livestock.cullexcess | команда | — | Kills livestock past livestock.maxPerSpecies, cattle and sheep counted apart: untamed animals first, then tame ones with no cupboard for a home, then the oldest and worst bred. An optional head count culls down to that instead. |
| livestock.curiousbreakdistance | конвар | 20 | How far (in metres) a player can get before a curious livestock animal gives up following them |
| livestock.curiouschance | конвар | 0.2 | The share of livestock born curious, so they follow a player they know without needing a lead; 0 disables curious animals |
| livestock.debugcondition | конвар | False | Adds the condition and its breeding band to a livestock animal's ai.showState read-out |
| livestock.debugdaybudget | конвар | False | Adds the day budget shares to a livestock animal's ai.showState read-out |
| livestock.debuggait | конвар | False | Adds walk speed and gait penalty to a livestock animal's ai.showState read-out |
| livestock.debuggenes | конвар | False | Adds an animal's genes to its ai.showState read-out |
| livestock.debugovergrazing | конвар | False | Logs livestock overgrazing as it happens |
| livestock.debugspecials | конвар | False | Logs each special livestock animal as it spawns |
| livestock.defendreactiontime | конвар | 5 | How recently (in seconds) a player the herd counts as one of its own must have been attacked for a bull to come after whoever is doing it; 0 stops him defending players |
| livestock.devnamechance | конвар | 0 | The chance a freshly named livestock animal is given a developer's handle instead of an ordinary name; one named that way never founds a dynasty |
| livestock.dung | команда | — | Makes the nearest livestock animal drop dung now, without waiting for its timer. Optional search radius in metres (default 20). |
| livestock.dungconditionfloor | конвар | 0.15 | Condition below which a livestock animal stops dunging at all. A starving animal never dungs whatever this says |
| livestock.dungconditionfull | конвар | 0.8 | Condition at or above which a livestock animal dungs at its full authored rate |
| livestock.dungslowestscale | конвар | 3 | How much longer a livestock animal at the condition floor waits between dung drops than one in its prime |
| livestock.dynasticnames | конвар | True | Whether a newborn livestock animal takes its same-sex parent's name one generation on, so a line reads Melk then Melk Junior then Melk the 3rd |
| livestock.emptyfullness | команда | — | Empties the nearest livestock animal's fullness, so it goes looking for food. Optional search radius in metres (default 20). |
| livestock.emptyhydration | команда | — | Empties the nearest livestock animal's hydration, so it goes looking for water. Optional search radius in metres (default 20). |
| livestock.emptysocial | команда | — | Empties the nearest livestock animal's social need, as if it had been on its own. Optional search radius in metres (default 20). |
| livestock.familiaritydistresspenalty | конвар | 30 | How many seconds of familiarity a player loses with the herd around an animal they hurt |
| livestock.familiarityforgetscale | конвар | 3 | How many seconds a player has to stay away from a livestock animal short of a full bond for it to forget one second they spent near it, so at 3 fourteen minutes are gone in forty two. A full bond never fades, 0 never forgets |
| livestock.familiarityhurtpenalty | конвар | 60 | How many seconds of familiarity a player loses with a livestock animal they hurt |
| livestock.familiarityradius | конвар | 20 | How close (in metres) a player has to be for a livestock animal to count the time; must sit inside the animal's sense radius; 0 disables familiarity |
| livestock.familiarityrate | конвар | 1 | Multiplies how fast livestock familiarity builds up; 20 makes a five minute bond take fifteen seconds. For testing, leave at 1 for play |
| livestock.fillfullness | команда | — | Fills the nearest livestock animal's fullness, as if it had just eaten its fill. Optional search radius in metres (default 20). |
| livestock.fillhydration | команда | — | Fills the nearest livestock animal's hydration, as if it had just drunk its fill. Optional search radius in metres (default 20). |
| livestock.fillsocial | команда | — | Fills the nearest livestock animal's social need, as if it were standing in a herd the right size. Optional search radius in metres (default 20). |
| livestock.forcebreed | команда | — | Sends the nearest male livestock animal to mate with the nearest valid female, skipping the mate search. Optional search radius in metres (default 20). |
| livestock.friskythreshold | конвар | 0.85 | How well met a livestock animal's worst need must be (0-1) before it will canter about for the fun of it; above 1 disables it |
| livestock.genebadchance | конвар | 0.3 | The chance each allele of a wild livestock animal is rolled Bad; the rest come out Ok |
| livestock.genedungbad | конвар | 0.6 | How often a Bad Dung livestock animal drops dung, as a share of an average one |
| livestock.genedunggood | конвар | 1.6 | How often a Good Dung livestock animal drops dung, as a multiple of an average one |
| livestock.genefertilitybad | конвар | 0.65 | How often a Bad Fertility livestock animal breeds, as a share of an average one; litter size never falls below one |
| livestock.genefertilitygood | конвар | 1.6 | How often a Good Fertility livestock animal breeds, and how many young it carries, as a multiple of an average one |
| livestock.genegoodchance | конвар | 0.2 | The chance each allele of a wild livestock animal is rolled Good |
| livestock.genehardinessbad | конвар | 0.7 | How well a Bad Hardiness livestock animal tolerates going short of food, water or room, as a share of an average one |
| livestock.genehardinessgood | конвар | 1.5 | How well a Good Hardiness livestock animal tolerates going short of food, water or room, as a multiple of an average one |
| livestock.genelongevitybad | конвар | 0.65 | How long a Bad Longevity livestock animal lives, as a share of an average one |
| livestock.genelongevitygood | конвар | 1.5 | How long a Good Longevity livestock animal lives, as a multiple of an average one |
| livestock.genemutationchance | конвар | 0 | The chance each inherited livestock allele is rerolled from scratch instead of coming from its parent; leaving this at 0 is what makes breeding predictable enough to reason about |
| livestock.genesenabled | конвар | True | Whether livestock genes do anything; off makes every animal an average one without touching the genomes they carry |
| livestock.geneyieldbad | конвар | 0.6 | How much milk or wool a Bad Yield livestock animal gives, as a share of an average one |
| livestock.geneyieldgood | конвар | 1.6 | How much milk or wool a Good Yield livestock animal gives, as a multiple of an average one |
| livestock.grazesuntilovergrazed | конвар | 2 | How many times livestock can graze one patch of grass before it is eaten bare |
| livestock.grudgeduration | конвар | 45 | How long (in seconds) a livestock animal stays wary of a player that hurt it or one of its herd, moving off when they come close again; 0 disables grudges |
| livestock.grudgerange | конвар | 8 | How close (in metres) a remembered aggressor has to get before a wary livestock animal moves off |
| livestock.inbredscale | конвар | 0.5 | What every gene's slider position is multiplied by on an inbred livestock animal, for its coat and for what it produces alike. At 0.5 a Good gene looks and performs as Ok and an Ok gene falls halfway to Bad. An animal is inbred when both its lineage markers match |
| livestock.leadbreakdistance | конвар | 7 | How far (in metres) a player can get from an animal they are leading before the lead breaks. 0 never breaks it |
| livestock.localenames | конвар | True | Whether livestock names follow the languages of whoever is connected; off names every animal from the English pool, as before the packs existed |
| livestock.makepregnant | команда | — | Makes the nearest livestock animal pregnant. Obeys standard breeding rules. Optional search radius in metres (default 20). |
| livestock.maxlittersize | конвар | 3 | The most young one livestock birth can ever produce, however good the mother's Fertility is |
| livestock.maxperspecies | конвар | 300 | How many livestock animals of one species a server holds before none of that species breeds. Cattle and sheep are counted apart against the same number, 0 never caps |
| livestock.maxtrust | конвар | 900 | The most seconds of trust a player can build with a livestock animal, which is the full bond: it can breed, standing in your cupboard makes that its home, your trust stops fading and a bull defends you |
| livestock.motherlyduration | конвар | 300 | How long (in seconds) a mother stands her ground for her own calf after something has threatened it, rather than running like any other cow; 0 disables maternal defence |
| livestock.namelocale | конвар | en | The language livestock are named in when nobody connected speaks one the game has names for, and the language the baseline weight reinforces |
| livestock.overgrazedareacooldownminutes | конвар | 30 | How long (in minutes) an overgrazed patch of grass takes to grow back |
| livestock.overgrazedarearadius | конвар | 5 | How far (in metres) an overgrazed patch of grass reaches from its centre |
| livestock.overgrazehere | команда | — | Marks the grass where the caller is standing as overgrazed, without waiting for a herd to eat it. |
| livestock.overgrazingenabled | конвар | True | Whether grass a herd has eaten bare stops feeding them until it grows back |
| livestock.panelage | конвар | True | Whether a farm animal's status panel says whether it is young or grown |
| livestock.panelalleles | конвар | False | Whether both copies of every livestock gene are shown rather than only the one the animal expresses. Reveals what an animal carries without breeding it |
| livestock.paneldung | конвар | False | Whether a farm animal's status panel shows how often it dungs, after its genes |
| livestock.panelgender | конвар | False | Whether the male and female symbols are shown next to a farm animal's name on its status panel |
| livestock.panelgenes | конвар | False | Whether the gene discs are shown on the livestock status panel, along with the inbred warning that explains them |
| livestock.paneltrust | конвар | False | Whether a farm animal's status panel shows how much it trusts you, as one segment per band of the trust ladder |
| livestock.panelyield | конвар | False | Whether a farm animal's status panel shows what it produces and how often, after its genes |
| livestock.priceageprime | конвар | 0.5 | How far through its life a livestock animal stays worth its full price, from 0 in its prime to 1 at death by old age |
| livestock.priceconditionfloor | конвар | 0.15 | Condition at or below which a livestock animal sells for the least a vendor will pay |
| livestock.priceconditionfull | конвар | 0.8 | Condition at or above which a livestock animal sells for the vendor's full price |
| livestock.pricefullqualityscale | конвар | 1.5 | The livestock sale value that counts as full quality, which is a full budget for the vendor's sale table |
| livestock.pricegeneweight | конвар | 1 | How far a livestock animal's genes move what a vendor pays, where 1 pays its full gene advantage and 0 prices every animal as an average one |
| livestock.priceoldestscale | конвар | 0.5 | What a livestock animal at the very end of its life sells for, as a share of the vendor's full price |
| livestock.pricewildpenalty | конвар | 0.85 | How much less a livestock animal that no player bred sells for, as a share of its price, so a herd raised from birth outsells one rounded up in the wild |
| livestock.priceworstscale | конвар | 0.4 | What a livestock animal at the condition floor sells for, as a share of the vendor's full price |
| livestock.profile | конвар | — | Times how long livestock spend in their needs queue and FSM tick, for livestock.census. Off by default because the measurement itself costs |
| livestock.readytomilk | команда | — | Makes the nearest cow ready to milk now, without waiting out its cooldown. Optional search radius in metres (default 20). |
| livestock.readytoshear | команда | — | Makes the nearest sheep ready to shear now, without waiting out its cooldown. Optional search radius in metres (default 20). |
| livestock.rename | команда | — | Renames the nearest livestock animal. Usage: livestock.rename <name> [radius], quoting a name that contains spaces, radius in metres (default 20) |
| livestock.sendhome | команда | — | Moves the wild anchor of every livestock animal in range to where the caller is standing, so roam and the night gather aim here. A cupboard still outranks it. Optional radius in metres (default 30). |
| livestock.setcondition | команда | — | Sets the condition of the livestock animal the caller is looking at, or the nearest one. Condition is the slow average that price, dung and willingness read. Usage: livestock.setcondition <0-1> [radius], radius in metres (default 20) |
| livestock.setcurious | команда | — | Makes the nearest livestock animal curious or not, so it will follow a player it knows without a lead. Usage: livestock.setcurious <0|1> [radius], radius in metres (default 20) |
| livestock.setfamiliarity | команда | — | Sets how many seconds of familiarity the calling player has with the livestock animal they are looking at, or the nearest one. Usage: livestock.setfamiliarity <seconds> [radius], radius in metres (default 20) |
| livestock.setfamiliarityall | команда | — | Sets how many seconds of familiarity the calling player has with every livestock animal in range. 0 resets them all. Usage: livestock.setfamiliarityall <seconds> [radius], radius in metres (default 30) |
| livestock.setgene | команда | — | Sets both copies of one gene on the livestock animal you are looking at, or the nearest one, the better copy being the one that shows. Usage: livestock.setgene <Dung|Longevity|Yield|Fertility|Hardiness> <firstAllele> <secondAllele> [radius], each allele Bad, Ok or Good |
| livestock.setinbred | команда | — | Makes the livestock animal you are looking at, or the nearest one, inbred or not, by forcing its two lineage markers together or apart. Usage: livestock.setinbred <0|1> [radius] |
| livestock.showcoat | команда | — | Prints what the nearest livestock animal's coat is made of, which is its genes and, for a species with patches, its name. Usage: livestock.showcoat [radius], radius in metres (default 20) |
| livestock.showgenes | команда | — | Prints the genes of the livestock animal you are looking at, or the nearest one, both copies of each, plus its lineage markers. Optional search radius in metres as the first argument (default 20). |
| livestock.showhome | команда | — | Draws an arrow from the livestock animal you are looking at, or the nearest one, to the cupboard it lives at, or to its wild anchor when it has none. Optional search radius in metres (default 20) and seconds to draw for (default 10). |
| livestock.spawnspecial | команда | — | Spawns one of the named special livestock animals in front of you, skipping the rarity roll but obeying every other rule. Usage: livestock.spawnspecial <name> [species], species being needed only for an entry that fits more than one |
| livestock.specialchance | конвар | 0.005 | The chance each wild livestock spawn is one of the named special animals; births, purchases, age-ups and saves never roll for one |
| livestock.specials | команда | — | Lists the special livestock animals this server has already produced, and counts the rest without naming them |
| livestock.swapgender | команда | — | Swaps the gender of the nearest livestock animal. Optional search radius in metres (default 20). |
| livestock.trustfloor | конвар | 60 | The seconds a livestock animal credits to the team, cupboard authed and door code sharers of anyone it is bonded with; kept inside the tolerated band on purpose |
| livestock.trusttofollow | конвар | 5 | How many seconds near a livestock animal before a curious one follows you without a lead |
| livestock.trusttolead | конвар | 300 | How many seconds near a livestock animal before you can lead it, after which it also ages, can starve and gives dung, milk or wool |
| livestock.trusttotolerate | конвар | 30 | How many seconds near a livestock animal before a bull stops squaring up at you |
| livestock.vendorannoyedtime | конвар | 900 | How many seconds a livestock vendor refuses to look at goods whose every offer was turned down |
| livestock.vendorgenerouschance | конвар | 0.05 | The chance each livestock offer is a generous one, where the vendor pays for a better animal than the one in front of him; 0 disables it |
| livestock.vendorgenerousmax | конвар | 0.25 | The most a generous livestock offer lifts an animal's quality by |
| livestock.vendorgenerousmin | конвар | 0.1 | The least a generous livestock offer lifts an animal's quality by |
| livestock.vendoroffercount | конвар | 3 | How many offers a livestock vendor makes for one animal before he is annoyed and stops buying |
| livestock.vendorofferitems | конвар | 2 | How many items a livestock vendor picks for one offer before paying the rest of its value in the sale table's fallback |
| livestock.vendoroffervariance | конвар | 0.05 | How far a livestock vendor's offer can swing either side of what an animal is really worth |
| livestock.vendorwoollotsize | конвар | 400 | How much wool counts as a full lot, which is a full budget for the vendor's wool table |
| livestock.vendorwoolminimum | конвар | 25 | How much wool a player must be carrying before a livestock vendor will haggle over it at all |
| livestock.wildconditionfloor | конвар | 0.5 | Lowest condition a livestock animal nobody can lead falls to from neglect, so wildlife never dies of it |
| log.level | команда | — | Sets the log verbosity level for a specific named RustLog channel; takes a channel name and optional level integer |
| lookattooltip.crosshairmode | конвар | 0 | Changes the interaction crosshair visuals (0 = default, 1 = no texts, 2 = no texts and no icon) |
| manifest.printmanifest | команда | — | Prints the Facepunch application manifest in a formatted summary showing app name, version, and platform details |
| manifest.printmanifestraw | команда | — | Prints the raw contents of the Facepunch manifest file as an unformatted string |
| maplayerrenderer.debuglabs | конвар | — | When enabled, draws debug visualisations on the map for underwater lab entrance locations and floor boundaries; admin-only |
| marchingcubesmanager.collidermiplevel | конвар | 1 | [0-2] - mip level the sculpture collision mesh is marched at. Each level is ~4x fewer collision triangles and a correspondingly cheaper physics bake, at the cost of the collider drifting slightly from the visual surface |
| marchingcubesmanager.debuglog | конвар | False | |
| marchingcubesmanager.generatorpoolcount | конвар | 4 | [1-16] - each generator has constant memory overhead, but will allow more to process at once |
| megaphone.megaphonevoicerange | конвар | 100 | |
| memsnap.full | команда | — | Takes a full Unity Memory Profiler snapshot capturing all managed, native, and graphics memory and saves it as a timestamped .snap file in profile/memory/ |
| memsnap.managed | команда | — | Takes a Unity Memory Profiler snapshot capturing managed (C#) heap allocations and saves it as a timestamped .snap file in the profile/memory/ folder |
| memsnap.native | команда | — | Takes a Unity Memory Profiler snapshot capturing native (C++) heap allocations and saves it as a timestamped .snap file in the profile/memory/ folder |
| meshpaintable3d.brushscale | конвар | 2 | Scale multiplier for the mesh paint brush size when painting on a 3D paintable surface |
| meshpaintable3d.uvbufferscale | конвар | 2 | Scale multiplier for the UV buffer texture used when projecting paint onto a 3D surface; higher values improve paint resolution |
| meta.add | команда | — | add <convar> <amount> - adds amount to convar |
| meta.exec | команда | — | exec [command_1] ... - runs all of the commands passed as arguments (also, if the last argument is true/false then that will flow into each command's arguments) |
| meta.if_false | команда | — | if_false <command> <condition> - runs a command if the condition is false |
| meta.if_true | команда | — | if_true <command> <condition> - runs a command if the condition is true |
| meta.reset_cycle | команда | — | reset_cycle <key> - resets a cycled bind to the beginning |
| metaldetectorflag.timeoutduration | конвар | 10800 | |
| metaldetectorsource.attemptspersubsourcespawn | конвар | 5 | |
| metaldetectorsource.draweditorgizmos | конвар | False | |
| metaldetectorsource.mindistancebetweensubsources | конвар | 1.5 | |
| metaldetectorsource.population | конвар | 1200 | Population active on the server, per square km |
| metaldetectorsource.servercountsources | команда | — | |
| metaldetectorsource.timeoutduration | конвар | 7200 | |
| minicopter.population | конвар | — | Population active on the server |
| mlrs.brokendownminutes | конвар | 20 | How many minutes before the MLRS recovers from use and can be used again |
| modularcar.outsidedecayminutes | конвар | 864 | How many minutes before a ModularCar loses all its health while outside |
| modularcar.population | конвар | 3 | Population active on the server |
| monumentnavmesh.use_baked_terrain_mesh | конвар | True | |
| mortar.debugdistanceui | конвар | — | |
| motorrowboat.decaystartdelayminutes | конвар | 45 | How long until decay begins after the boat was last used |
| motorrowboat.deepwaterdecayminutes | конвар | 120 | How long before a boat loses all its health while in deep water |
| motorrowboat.outsidedecayminutes | конвар | 180 | How long before a boat loses all its health while outside. If it's in deep water, deepwaterdecayminutes is used |
| motorrowboat.population | конвар | 1 | Population active on the server |
| mountedweapon.antihack_level | конвар | 0 | |
| mountedweapon.antihack_max_degrees_per_second_pitch | конвар | 720 | |
| mountedweapon.antihack_max_degrees_per_second_yaw | конвар | 720 | |
| mountedweapon.antihack_max_snap_degrees | конвар | 35 | |
| mountedweapon.debug | конвар | False | |
| mountedweapon.enable_client_authority | конвар | True | |
| music.enabled | конвар | True | Enables the in-game dynamic music system; disabling stops all background music tracks from playing |
| music.info | команда | — | Prints the name of the currently playing music track and its playback position to the console |
| music.songgapmax | конвар | 480 | Maximum seconds of silence between background music tracks; a random gap between songGapMin and songGapMax is chosen between songs |
| music.songgapmin | конвар | 240 | Minimum seconds of silence between background music tracks; the game waits at least this long before starting the next song |
| nametags.enabled | конвар | True | When enabled, player name tags are shown above other players; disable to hide all name tags on the client; saved between sessions |
| nametags.showindemos | конвар | False | When enabled, name tags are also shown while watching a demo; demos hide name tags by default |
| navstress.bench | команда | — | Run the full benchmark suite: args agentCount (default 200) |
| navstress.benchresults | команда | — | Print the last benchmark results |
| navstress.build_env | команда | — | Build the synthetic stress field: args centerX centerZ halfExtent (defaults -140 140 50) |
| navstress.chase | команда | — | Chase a sliding virtual target: args targetSpeed setDestinationHz |
| navstress.clear | команда | — | Despawn dummies and remove the field |
| navstress.envreport | команда | — | Print the last environment build report |
| navstress.idle | команда | — | Stop giving destinations and reset paths |
| navstress.killforeign | команда | — | Kill every NPC with a RustNavMeshAgent that is not a navstress dummy |
| navstress.rebuildstorm | команда | — | Async tile rebuilds under the field: args rebuildsPerSecond (0 stops) |
| navstress.refcompare | команда | — | Replay the scenario and compare against a recording: args name |
| navstress.refrecord | команда | — | Record the reference trajectory scenario: args name |
| navstress.refresults | команда | — | Print the last refpath result |
| navstress.setmode | команда | — | Flip all dummies between steering and normal mode without respawning |
| navstress.spawn | команда | — | Spawn stripped wolves: args count mode(steering|normal) canSwim canOpenDoors |
| navstress.stats | команда | — | Print and reset tick statistics |
| navstress.wander | команда | — | Random destinations forever: args intervalSeconds unreachableFraction |
| net.debug | конвар | False | Enables verbose client-side network debug logging, printing all incoming and outgoing message types and their byte sizes |
| net.global_network_debug | конвар | False | Toggle printing time taken to send all global entities to client when they connect |
| net.global_networked_bases | конвар | True | When enabled, base entities are networked to all clients regardless of distance; disabling restricts base updates to players within the normal visibility radius |
| net.limit_global_update_broadcast | конвар | True | (default) true = only broadcast to clients with global networking enabled, false = broadcast to every client regardless |
| net.network_group_debug | конвар | False | Toggle checking network group bounds whenever an entity changes its network group |
| net.visdebug | конвар | False | When enabled, logs network visibility group changes to the server console, showing when entities enter or leave a player visibility radius |
| net.visibilityradiusdeepsea | конвар | 10 | Network visibility radius in grid cells used in the deep-sea zone; kept smaller than overworld to limit underwater entity update overhead |
| net.visibilityradiusfaroverride | конвар | -1 | Overrides the far network visibility radius in grid cells; -1 = use default; increase to send more distant entity updates to clients |
| net.visibilityradiusnearoverride | конвар | -1 | Overrides the near (high-priority) network visibility radius in grid cells; -1 = use default |
| networkprofiler.packet_capture | команда | — | networkprofiler.packet_capture [max size(in MB), min(1), max(10000), float] [max duration(in seconds), min(1), max(3600), float] |
| networkprofiler.serverprofile | команда | — | networkprofiler.serverprofile [time to profile(in seconds), min(0.1), max(1000), float] |
| networkprofiler.stop_packet_capture | команда | — | networkprofiler.stop_packet_capture - ends the running packet capture early |
| nexus.broadcast_ping | команда | — | Sends a ping to all Nexus servers in the cluster simultaneously and prints individual round-trip times |
| nexus.clanclatbatchduration | конвар | 1 | Maximum duration in seconds to batch clan chat messages to send to other servers on the nexus |
| nexus.defaultzonecontactradius | конвар | 0.33 | Default distance between zones to allow boat travel, if map.contactRadius isn't set in the nexus (uses normalized coordinates) |
| nexus.endpoint | конвар | https://gw.facepunch.com/nexus/ | URL endpoint to use for the Nexus API |
| nexus.hidefullislands | конвар | False | Hide islands that we know are full, preventing players from being transferred to them |
| nexus.islandspawndistance | конвар | 1.5 | How far away islands should be spawned, as a factor of the map size |
| nexus.loadingtimeout | конвар | 900 | Time in seconds to keep players in the loading state before going to sleep |
| nexus.logging | конвар | True | When enabled, logs all Nexus zone transfer and communication events to the server console; useful for debugging cross-server player transfers |
| nexus.mapimagescale | конвар | 0.5 | Scale of the map to render and upload to the nexus |
| nexus.messagelockduration | конвар | 5 | Time in seconds to allow the server to process nexus messages before re-sending (requires restart) |
| nexus.ping | команда | — | Sends a ping to a specific Nexus server by name and prints the round-trip latency; used for testing inter-server connectivity |
| nexus.pinginterval | конвар | 30 | Time in seconds to wait between server status pings |
| nexus.playermanifestinterval | конвар | 30 | Interval in seconds to broadcast the player manifest to other servers on the nexus |
| nexus.playeronline | команда | — | Checks whether the named or Steam-ID-specified player is currently online on any server in the Nexus cluster |
| nexus.protectionduration | конвар | 300 | Maximum time in seconds to keep transfer protection enabled on entities |
| nexus.refreshislands | команда | — | Forces a refresh of the Nexus island layout, re-querying the zone controller for current island assignments |
| nexus.rpctimeoutmultiplier | конвар | 1 | Multiplier for nexus RPC timeout durations in case we expect different latencies |
| nexus.secretkey | конвар | | Shared secret key used to authenticate Nexus inter-server communication; must match across all servers in the same Nexus cluster |
| nexus.timeoffset | конвар | 0 | Time offset in hours from the nexus clock |
| nexus.transfer | команда | — | Initiates a Nexus transfer of the specified player to a named destination server or zone in the cluster |
| nexus.transferflushtime | конвар | 60 | Maximum amount of time in seconds that transfers should be cached before auto-saving |
| nexus.uploadmap | команда | — | Reupload the map image to the nexus. Normally happens automatically at server boot. WARNING: This will lag the server! |
| nexus.zonecontroller | конвар | basic | Name of the zone controller implementation used for this Nexus server (e.g. basic, advanced); controls how players are routed between servers |
| nobuildzonematerialcontroller.setheight | команда | — | [0.0-10] |
| nobuildzonematerialcontroller.setstrengthday | команда | — | [0.0-1.0] |
| nobuildzonematerialcontroller.setstrengthnight | команда | — | [0.0-1.0] |
| note.update | команда | — | |
| npc.vendor_attack_heli_enabled | конвар | True | |
| npc.vendor_hab_enabled | конвар | True | |
| npc.vendor_minicopter_enabled | конвар | True | |
| npc.vendor_rhib_enabled | конвар | True | |
| npc.vendor_rowboat_enabled | конвар | True | |
| npc.vendor_scrap_heli_enabled | конвар | True | |
| npc.vendor_sub_duo_enabled | конвар | True | |
| npc.vendor_sub_solo_enabled | конвар | True | |
| npcanimcontroller.lookinterpspeed | конвар | 3 | |
| npcanimcontroller.spineinterpspeed | конвар | 3 | |
| npcautoturret.forcedamageblockedsleepers | конвар | True | If an npc turret is firing at a sleeping player and the player is blocked, still apply damage |
| npcautoturret.sleeperhostiledelay | конвар | 1200 | How many seconds until a sleeping player is considered hostile |
| npcvendingmachine.addhours | команда | — | Simulates the provided number of hours passing in the vending machine system |
| npcvendingmachine.dynamicpricingenabled | конвар | True | Whether to run the the dynamic pricing system |
| npcvendingmachine.maximumpricemultiplier | конвар | 2 | The maximum point that a price can increase to (2 = 200%) |
| npcvendingmachine.minimumpricemultiplier | конвар | 0.5 | The Minimum point that the price can drop to (0.5 = 50% off) |
| npcvendingmachine.pricedecreaseamount | конвар | 0.05 | How much to decrease the price for if it is underselling (0.05 = 5%) |
| npcvendingmachine.priceincreaseamount | конвар | 0.1 | How much to increase the price by if it is selling a lot (0.05 = 5%) |
| npcvendingmachine.priceupdatefrequencybiweekly | конвар | 2 | How many realtime hours are checked when looking for price increases. Max 72 (10 days), min 0.5 (half an hour) |
| npcvendingmachine.priceupdatefrequencydefault | конвар | 3 | How many realtime hours are checked when looking for price increases. Max 72 (10 days), min 0.5 (half an hour) |
| npcvendingmachine.priceupdatefrequencyweekly | конвар | 1 | How many realtime hours are checked when looking for price increases. Max 72 (10 days), min 0.5 (half an hour) |
| npcvendingmachine.printallpricechanges | команда | — | Print out all current price changes on the server |
| npcvendingmachine.resetdynamicpricing | команда | — | Resets the state of all discounts and surcharges from NPC vending machines |
| npcvendingmachine.resetfrequencytags | команда | — | |
| npcvendingmachine.startingpricemultiplier | конвар | 2 | What discount surcharge should be applied to items when the server starts |
| panther.population | конвар | 0.5 | Population active on the server, per square km |
| parachute.bypassrepack | конвар | False | |
| parachute.landinganimations | конвар | False | |
| party.maxpartyspawnattempts | конвар | 50 | Maximum number of attempts the server makes to find a valid spawn point when spawning a party together; higher values increase the chance of grouping |
| party.maxpartyspawndistance | конвар | 100 | Maximum distance in metres between party member spawn points when spawning a group together on wake-up |
| party.nearbypartyspawns | конвар | True | When enabled, party members respawn near each other rather than at random map locations when joining a server together |
| patrolhelicopterai.dumpstate | команда | — | Dumps the current patrol helicopter AI state to the console including state machine, targets, orbit state, and retire status |
| patrolhelicopterai.flee_damage_percentage | конвар | 0.35 | Fraction of maximum health at which the patrol helicopter will break off its attack and flee; default 0.35 (35%) |
| patrolhelicopterai.monument_crash | конвар | True | When enabled, the patrol helicopter prefers to crash into a monument area when destroyed rather than crashing in open terrain |
| patrolhelicopterai.use_danger_zones | конвар | True | When enabled, the patrol helicopter avoids designated danger zones during its patrol route |
| petbrain.controldistance | конвар | 100 | |
| petbrain.drownindeepwater | конвар | True | |
| petbrain.drowntimer | конвар | 15 | |
| petbrain.idlewhenownermounted | конвар | True | |
| petbrain.idlewhenownerofflineordead | конвар | True | |
| physics.allowhorsetempragdoll | конвар | True | When enabled, horses can be temporarily ragdolled by large physics impacts; disabling keeps horses upright during collisions |
| physics.allowplayertempragdoll | конвар | True | When enabled, players can be temporarily ragdolled by large physics impacts (e.g. explosions) before recovering; disabling keeps players standing |
| physics.autosynctransforms | конвар | — | When enabled, Unity Physics auto-syncs transform changes to physics each frame; disable to manually control when transforms sync |
| physics.batchsynctransforms | конвар | True | When enabled, physics transform syncs are batched per frame for efficiency; disable to force immediate per-object sync |
| physics.bouncethreshold | конвар | — | Minimum relative velocity at which a physics collision generates a bounce response; lower values cause more objects to bounce on light impacts |
| physics.droppedmode | конвар | 2 | The collision detection mode that dropped items and corpses should use |
| physics.getbounds | команда | — | Prints the combined world-space bounding box of the entity the calling admin is looking at; useful for verifying collider extents |
| physics.gravity | конвар | 1.0 | Gravity multiplier |
| physics.groundwatchdebug | конвар | False | When enabled, logs ground-watch trigger events to the console, showing when players are detected as off the ground or falling through the world |
| physics.groundwatchdelay | конвар | 0.1 | Seconds between ground-watch checks on a player; lower values detect world-fall issues faster but increase CPU overhead |
| physics.groundwatchfails | конвар | 1 | Number of consecutive ground-watch failures allowed before corrective action is taken on a player who appears to be falling through geometry |
| physics.print_colliders_per_cell | команда | — | Prints a sorted table of physics cells and how many colliders each contains; helps identify areas with excessive collider density causing physics slowdowns |
| physics.print_colliders_per_prefab | команда | — | Prints a sorted table of prefab names and their collider counts; identifies prefabs with unusually high collider counts for optimisation |
| physics.sendeffects | конвар | True | Send effects to clients when physics objects collide |
| physics.serverragdollmode | конвар | 3 | The collision detection mode that server-side ragdolls should use |
| physics.serversideragdolls | конвар | False | Do ragdoll physics calculations on the server, or use the old client-side system |
| physics.setbounds | команда | — | (center vec3) (extents vec3) |
| physics.sleepthreshold | конвар | — | Energy threshold below which a rigid body is put to sleep by the physics engine; lower values keep more objects awake, higher values reduce CPU usage |
| physics.solveriterationcount | конвар | — | The default solver iteration count permitted for any rigid bodies (default 7). Must be positive |
| physics.towingmaxlinearaccelfromjoint | конвар | 40 | Maximum linear acceleration (m/s^2) that a vehicle towing joint can apply before the joint breaks; prevents unrealistic joint forces during towing |
| physics.treecollision | конвар | True | Do players and vehicles collide with trees? |
| physicstumblingentity.angular_drag_override | конвар | -1 | Override for rigidbody angular drag. Set to -1 to disable. |
| physicstumblingentity.drag_override | конвар | -1 | Override for rigidbody drag. Set to -1 to disable. |
| physicstumblingentity.max_tumbling_force | конвар | 1000 | Maximum force applied on collision to cause tumbling |
| physicstumblingentity.min_tumbling_force | конвар | 600 | Minimum force applied on collision to cause tumbling |
| physicstumblingentity.player_impulse_multiplier | конвар | 10 | Multiplier for impulse applied to players when ragdolled by this entity |
| physicstumblingentity.tumbling_force_cone_angle | конвар | 30 | Cone angle in degrees for randomizing tumbling force direction |
| physicstumblingentity.velocity_threshold_for_tumbling_force | конвар | 1.5 | Minimum velocity required for an object to get tumbling force applied on collision |
| ping.auto_refresh_region | конвар | — | When enabled, region ping estimates are automatically refreshed in the background to keep server list latency data up to date |
| ping.ping_estimate_logging | конвар | — | When enabled, logs ping estimation results to the console; useful for debugging regional latency measurement accuracy |
| ping.ping_estimation | конвар | — | When enabled, the ping estimator collects latency samples to regional servers; disable to suppress background ping traffic |
| ping.ping_parallel | конвар | — | When enabled, ping estimation sends samples to all servers in parallel for faster results; uses more bandwidth simultaneously |
| ping.ping_refresh_interval | конвар | — | Interval in minutes between automatic background ping estimation refreshes for server list region latency sorting |
| ping.ping_samples | конвар | — | Number of ping samples collected per estimation cycle; more samples give a more accurate average latency but take longer to complete |
| planterbox.outsidetestdistance | конвар | 100 | Maximum distance in metres used when raycasting to determine whether a planter box is outdoors and receiving natural sunlight |
| planterboxstatic.deepsearespawnchecktimer | конвар | 600 | Interval in seconds between respawn checks for growable plants in static planter boxes inside the deep sea zone; default 600s |
| planterboxstatic.favourablegenechance | конвар | 0.5 | Chance of a favourable gene being picked [0-1]. Setting this to 0 does not ensure no favourable genes are picked up, but it greatly reduces the chances. |
| player.abandonmission | команда | — | |
| player.adminsafezonelooting | конвар | False | Should admins be allowed to loot incapacitated players (or their corpse / bag) in safe-zones? |
| player.cinematic_gesture | команда | — | |
| player.cinematic_play | команда | — | |
| player.cinematic_stop | команда | — | |
| player.clearhostile | команда | — | Clear your hostile flag |
| player.copyrotation | команда | — | |
| player.createskull | команда | — | Creates a human skull item named after the given player name (or a random name if none given) and gives it to the calling player's inventory |
| player.createtrophy | команда | — | Creates a trophy head bag item for the specified entity type (by prefab name) and gives it to the calling player; used to generate mount-style trophy items for testing |
| player.dismount | команда | — | Forces the specified player (by ID) to dismount from any vehicle or mountable they are currently seated in; admin/developer/cinematic mode only |
| player.dropbackpackondeath | конвар | True | When enabled, players drop their backpack as a loot bag when they die; disable to prevent backpack loot from appearing on death |
| player.dropbackpackondowned | конвар | True | When enabled, players drop their backpack when downed/wounded; disable to keep the backpack on the body until death or recovery |
| player.fillwater | команда | — | <fresh/salt/rads> - Fills up liquid container items in your hotbar as well as any liquid containers you are looking at |
| player.gesture_radius | команда | — | Forces all players within a given radius (including the caller) to play one of the specified gesture names chosen at random; admin only; args: radius gesture1 [gesture2...] |
| player.gesture_radius_notme | команда | — | Same as gesture_radius but excludes the calling admin from the gesture; forces all other players within the radius to perform a random gesture from the provided list |
| player.gotosleep | команда | — | Forces the specified sleeping player (by ID) to enter the sleep state; admin/developer/cinematic mode only; also works on bots |
| player.infiniteammo | конвар | False | When enabled, the local player has unlimited ammo and never needs to reload; intended for testing and cinematic use only |
| player.keepteaondeath | конвар | False | When enabled, tea/buff effects active on a player at the time of death are carried over to their next life instead of being lost |
| player.markhostile | команда | — | Marks the calling player as hostile immediately, triggering the hostile timer as if they had attacked another player; useful for testing hostile-state dependent behaviour |
| player.mount | команда | — | |
| player.printpresence | команда | — | Prints the calling player's current time-category presence flags: whether they are in wilderness, base, monument, swimming, boating, or flying |
| player.printstats | команда | — | Prints detailed life-story stats for the calling player including time alive, distances travelled, damage taken/healed, kills, and per-weapon accuracy |
| player.ragdoll | команда | — | optional param {player} |
| player.ragdollall | команда | — | ragdolls |
| player.ragdollallbutme | команда | — | ragdolls everyone except player |
| player.ragdollother | команда | — | Ragdolls a player you're looking at |
| player.reloadweapons | команда | — | Fully reloads all projectile weapons, flamethrowers, and liquid weapons in every belt slot of the calling player; useful for testing without consuming ammo |
| player.resetmissions | команда | — | Resets the saved missions progress of the given player |
| player.resetmissions_all | команда | — | Resets the saved missions progress of all player states on this server (online and offline players). Must be entered as "resetmissions_all Y" to execute. |
| player.resetstate | команда | — | Resets the PlayerState of the given player |
| player.stopgesture_radius | команда | — | Cancels any active gesture on all players within the specified radius of the calling admin; admin only; useful for stopping mass-gesture cinematics |
| player.swapseat | команда | — | Moves the specified player (by ID) to the given seat index on the vehicle they are mounted in; admin/developer/cinematic mode only |
| player.tickrate_cl | конвар | 32 | |
| player.tickrate_sv | конвар | 16 | |
| player.trigger_wildlife_trap | команда | — | Admin-only: triggers the trap-think logic on the wildlife trap the calling player is looking at within 5 metres, simulating a catch attempt for testing |
| player.unloadweapons | команда | — | Empties the ammo from all projectile weapons, flamethrowers, and liquid weapons in every belt slot of the calling player; useful for testing reload behaviour |
| player.wakeup | команда | — | Wakes up the specified sleeping player (by ID), ending their sleep state immediately; admin/developer/cinematic mode only |
| player.wakeupall | команда | — | Wakes up all sleeping players on the server at once; admin/developer/cinematic mode only; useful for clearing the sleeping player list after a wipe |
| player.woundforever | конвар | False | Whether the crawling state expires |
| playerboat.aboardplayercheckinterval | конвар | 2 | Interval in seconds between checks to determine whether any players are still aboard the boat |
| playerboat.anchoreddriftdelayseconds | конвар | 21600 | Time in seconds after a boat is anchored before it becomes eligible for shore drift; default 21600s (6 hours) |
| playerboat.corpseseconds | конвар | 1800 | How long until player boat corpses despawn |
| playerboat.debugvis | конвар | — | When enabled, draws debug visualisations for player boat state including drift target, shore direction, and power zones |
| playerboat.decayminutes | конвар | 720 | How long before a boat loses all its health while outside |
| playerboat.decaystartdelayminutes | конвар | 1440 | How long until decay begins after the boat was last used |
| playerboat.deepseatransitionpowerdowngraceduration | конвар | 10 | Duration in seconds after entering the deep sea zone that a player boat has before its engine is powered down |
| playerboat.deployandeditanywhere | конвар | False | Allow Deploy & Edit anywhere in the ocean, bypassing location checks. |
| playerboat.destructiblewrecksenabled | конвар | True | |
| playerboat.dragbyangle_exponent | конвар | 0.4 | |
| playerboat.dragbyangle_maxcontrib | конвар | 50 | |
| playerboat.dragbyangle_maxdrag | конвар | 2.2 | |
| playerboat.dragbyangle_mincontrib | конвар | 5 | |
| playerboat.dragbyangle_mindrag | конвар | 0.65 | |
| playerboat.editenabled | конвар | True | |
| playerboat.enginepositioninfluences | конвар | 0.05 | 0 - 1 |
| playerboat.finisheditingenabled | конвар | True | |
| playerboat.hammerrepairenabled | конвар | True | |
| playerboat.kill_all_above_block_count | команда | — | Kills all player boats that have more building blocks than the given threshold; used for server cleanup |
| playerboat.kill_all_above_deployable_count | команда | — | Kills all player boats that have more deployed entities than the given threshold; used for server cleanup |
| playerboat.kill_io_deployables | команда | — | Kills any IO entities deployed on boats. Not a fast command. Use sparingly when needed. |
| playerboat.kill_nonconvex_deployables | команда | — | Kills any entities deployed on boats with non-convex colliders. Not a fast command. Use sparingly when needed. |
| playerboat.lookatdragbyangle | команда | — | Prints drag force debug data based on the angle between the boat heading and player look direction; admin-only |
| playerboat.maxblockcount | конвар | 180 | |
| playerboat.maxdeployablecount | конвар | 120 | |
| playerboat.orphansendimmediate | конвар | True | When enabled, deployables on boats send immediate network updates when orphaned during edit mode to prevent looping sounds from being killed |
| playerboat.placementupthreshold | конвар | 30 | Maximum angle in degrees from vertical at which building blocks can be placed on a player boat; default 30 degrees |
| playerboat.powerdownonnoplayers | конвар | True | When enabled, player boat engines are powered down when no players are aboard; prevents runaway unmanned boats |
| playerboat.print_nonconvex | команда | — | Prints a list of boats with non-convex collider deployables. Not a fast command. Use sparingly when needed. |
| playerboat.print_stats | команда | — | Prints statistics about all player boats on the server including block counts, deployable counts, and resource totals |
| playerboat.sailpositioninfluence | конвар | 0.1 | 0 - 1 |
| playerboat.setsailsopen | команда | — | Opens all sails on the player boat directly in front of the calling admin player; admin-only dev command |
| playerboat.sink | команда | — | Instantly kills the player boat directly in front of the calling admin player; admin-only dev command |
| playerboat.usedestructiblewreckstability | конвар | True | |
| playerboat.velocitymax | конвар | 15 | |
| playerhelicopter.insidedecayminutes | конвар | 2880 | How long before a player helicopter loses all its health while indoors |
| playerhelicopter.outsidedecayminutes | конвар | 480 | How long before a player helicopter loses all its health while outside |
| playerinventory.directionaldropenabled | конвар | True | When enabled, players can directionally drop items by looking in the desired direction; disable to revert to gravity-only drops |
| playerinventory.forcebirthday | конвар | False | When enabled, forces the birthday event state to true regardless of the actual date; overrides IsBirthday() calendar check for testing |
| polarbear.population | конвар | 1 | Population active on the server, per square km |
| pool.clear_assets | команда | — | Clears all cached entries from the asset pool matching the optional name filter |
| pool.clear_memory | команда | — | Clears all entries from the object memory pool matching the optional name filter; freed pooled objects are garbage collected |
| pool.clear_prefabs | команда | — | Clears all cached prefab instances from the prefab pool matching the optional filter, across client, server, and generic pools |
| pool.debug | конвар | False | When enabled, logs additional diagnostic information about pool hits, misses, and spills to the console |
| pool.enabled | конвар | True | When enabled, this system is globally active; disable to deactivate the system for the current session |
| pool.export_prefabs | команда | — | Exports the current prefab pool contents to a prefabs.csv file listing pool ID, prefab short name, and instance count |
| pool.fill_prefabs | команда | — | Pre-warms the prefab pool by instantiating and pooling prefabs matching the optional filter up to the given count override |
| pool.mode | конвар | 2 | When enabled, object pools are pre-allocated at startup to avoid first-use latency; increases startup time but reduces runtime GC stutter |
| pool.prewarm | конвар | True | When enabled, object pools are pre-allocated at startup to avoid first-use latency; increases startup time but reduces runtime GC stutter |
| pool.print_arraypool | команда | — | Prints a usage report for the BaseNetwork and ProtocolParser array pools, showing bucket sizes, capacities, and hit/miss stats |
| pool.print_assets | команда | — | Prints a table of all asset pool entries showing asset type, current pooled count, and pool capacity |
| pool.print_memory | команда | — | Prints a table of all object pool entries showing type, capacity, active count, peak usage, hit/miss counts, and spill counts; supports --json |
| pool.print_prefabs | команда | — | Prints a table of all prefab pool entries showing prefab name, miss count, current count, target capacity, and push/pop counts; supports --json |
| pool.reset_max_pool_counter | команда | — | Resets the peak-usage high-water-mark counter for all pools, allowing fresh measurement of maximum pool demand |
| pooltable.debug_pool | конвар | False | |
| pooltable.idle_reset_seconds | конвар | 180 | Anyone can reset a pool game nobody has interacted with for this many seconds |
| pooltable.physics_update_rate | конвар | 64 | |
| pooltable.show_tooltips | конвар | False | Show pool game tooltip notifications |
| pooltable.watch_after_shot_seconds | конвар | 2 | Seconds the shooter stays seated watching their shot before being dismounted |
| powergrid.enabled | конвар | True | If disabled power grid functionality will be disabled. |
| powergrid.fusedecayhighpop | конвар | 100 | Connected player count at or above which heavy fuses in the power plant decay at their normal rate. See fuseDecayLowPop. |
| powergrid.fusedecaylowpop | конвар | 10 | Connected player count at or below which heavy fuses in the power plant decay at fuseDecayLowPopScale times the normal rate. Decay rate scale rises linearly as pop increases to fuseDecayHighPop where scale returns to 1x. |
| powergrid.fusedecaylowpopscale | конвар | 0.25 | Multiplier on the decay rate of heavy fuses in the power plant while the connected player count is at or below fuseDecayLowPop. At 1 the player count has no effect on decay. |
| powergrid.fusefulldecaycount | конвар | 3 | How many of the worst condition heavy fuses in the power plant decay at the full rate (burning out after fuseLifespanSeconds). Every other inserted fuse decays slowly instead. If 0 no fuse ever decays at the full rate. |
| powergrid.fuselifespanseconds | конвар | 9600 | How long a heavy fuse plugged into the power plant lasts while it is decaying at the full rate (how long the worst fuses in the power plant survive for). If <= 0 then fuses last forever. |
| powergrid.fuseslowdecayfractionmax | конвар | 0.12 | Maximum fraction (0-1) of the full decay rate applied to heavy fuses that aren't one of the worst fuseFullDecayCount. See fuseSlowDecayFractionMin. |
| powergrid.fuseslowdecayfractionmin | конвар | 0.08 | Minimum fraction (0-1) of the full decay rate applied to heavy fuses that aren't one of the worst fuseFullDecayCount. Each fuse rolls its own fraction between fuseSlowDecayFractionMin and fuseSlowDecayFractionMax and keeps it for its lifetime. |
| powergrid.fusestatus | команда | — | |
| powergrid.greenrecyclerfullefficiencystage | конвар | -1 | Required powergrid stage for green recyclers to return to baseline efficiency. If < 0 then will use the default values. |
| powergrid.marketplacechargecapacity | конвар | 100 | Charge capacity of a drone marketplace's power buffer. A marketplace charges this up from the power plant and bleeds it back out whenever the plant stops carrying it. |
| powergrid.marketplacechargeperfuse | конвар | 0.01 | Charge a drone marketplace gains every second for each heavy fuse inserted at the power plant, once there are at least marketplaceMinimumFusesToCharge of them. |
| powergrid.marketplacedrainrate | конвар | 0.05 | Charge a drone marketplace loses every second while there are no heavy fuses inserted at the power plant. A single fuse is enough to stop the bleed. |
| powergrid.marketplaceminimumfusestocharge | конвар | 4 | Heavy fuses that have to be inserted at the power plant before a drone marketplace starts charging. Below this it holds whatever charge it has without building any more. |
| powergrid.marketplacerequiredchargefraction | конвар | 0.5 | Fraction (0-1) of its capacity a drone marketplace needs charged to accept orders. Sets both how long a cold marketplace takes to come online and how long a full one keeps running after the power plant drops out. |
| powergrid.powerlinebasepoweroutput | конвар | 5 | Starting power output of powerline poles when 1 heavy fuse is inserted at the power plant. |
| powergrid.powerlinemaxpoweroutput | конвар | 50 | Power output of powerline poles when all possible heavy fuses are inserted at the power plant. |
| powergrid.simulatepowerplantfuses | конвар | 0 | Pretend there are this many additional heavy fuses currently plugged into the power plant. Can input negative numbers to negate the effect of any currently plugged in fuses. |
| powergrid.stagechangeworkqueuebudget | конвар | 0.1 | Max time per frame (ms) to spend notifying powergrid entities of a stage change. |
| powergrid.stagechangeworkqueuedelaybetweenjobs | конвар | 0 | Time to wait (s) between each individual entity getting notified of a powergrid stage change. Higher values will delay the time it takes for all entities to receive notification of a stage change. Entities can skip this wait with stageChangeWorkQueueGroupJobsDistance |
| powergrid.stagechangeworkqueuegroupjobsdistance | конвар | 20 | If a powergrid entity is within this range of the first powergrid entity to receive a stage change update this frame, then that entity will also receive an update (skipping stageChangeWorkQueueTimeBetweenJobs) |
| powergrid.status | команда | — | |
| profile.command_lagspike_threshold | конвар | — | |
| profile.countsyncmoveentities | команда | — | Counts and prints all entities that use synchronous movement updates grouped by prefab, helping identify expensive per-frame entity movers |
| profile.dump_profile_recorders | команда | — | Dumps all available Unity Profiler recorder handles to CSV format showing name, category, unit type, and flags; useful for discovering available performance metrics |
| profile.exportintervals | конвар | — | Interval in seconds between automatic exports of server profiler data to disk; lower values provide more frequent snapshots at a higher I/O cost |
| profile.flush_analytics | команда | — | Flushes any buffered analytics events immediately to the analytics backend rather than waiting for the next scheduled flush |
| profile.immediatemodeenabled | конвар | — | When enabled, the server native profiler runs in immediate mode, capturing every frame rather than sampling; more accurate but higher overhead |
| profile.logentityspawntime | конвар | — | Log how long entities take to spawn on the client, use 'minloggedspawntime' to filter low spawn times |
| profile.logentityspawntime_min | конвар | — | Minimum spawn time before logging (in ms) |
| profile.notifyonmainalloccount | конвар | 0 | Main-thread allocation count threshold per tick for profiler notifications; 0 = disabled; helps isolate main-thread GC pressure |
| profile.notifyonmainmemkb | конвар | 0 | Main-thread memory usage threshold in kilobytes for profiler notifications; 0 = disabled |
| profile.notifyontotalalloccount | конвар | 16000 | Allocation count threshold (per profiler tick) above which the native continuous profiler fires a notification; useful for detecting unexpected allocation spikes |
| profile.notifyontotalmemkb | конвар | 12288 | Total managed memory threshold in kilobytes above which the native profiler fires a notification; helps detect memory leaks during long server runs |
| profile.notifyonworkeralloccount | конвар | 0 | Worker-thread allocation count threshold per tick for profiler notifications; 0 = disabled; helps detect background task GC pressure |
| profile.notifyonworkermemkb | конвар | 0 | Worker-thread memory usage threshold in kilobytes for profiler notifications; 0 = disabled |
| profile.perfsnapshot | команда | — | profile.perfsnapshot [delay=15, int] [name='Profile', str, no extension, max 32chars] [frames=10, int, max 10] [debug=false, dumps a binary snapshot as well]
Will produce a JSON perf snapshot of <frames> that can be viewed in Perfetto or similar tools |
| profile.perfsnapshot_stream | команда | — | profile.perfsnapshot_stream [name='Profile', str, no extension, max 32chars] [MainCap=32, int, max 256, buffer size for Main thread in Megabytes] [WorkerCap=8, int, max 256, buffer size for each Worker thread in Megabytes] [debug=false, dumps a binary snapshot as well]
Will stream <mainCap>MB worth of data and generate a JSON snapshot that can be viewed in Perfetto or similar tools |
| profile.profiling_entities | конвар | — | 0 = off, 1 = spawn/kill, 2 = spawn/kill per entity, 3 = count every '5 min' |
| profile.profiling_entity_count_interval | конвар | — | How frequently to count all entities across the server |
| profile.profiling_fixed_invokes | конвар | — | 0 = off, 1 = stats per frame, 2 = stats per method |
| profile.profiling_invokes | конвар | — | 0 = off, 1 = stats per frame, 2 = stats per method |
| profile.profiling_lagspikes | конвар | — | Record inbound RPC & ConsoleCommands that cause lag spikes |
| profile.profiling_packets | конвар | — | Record type of packets inbound/outbound per frame |
| profile.profiling_ping | конвар | — | Raknet statistics, 0 = off, 2 = per connection |
| profile.profiling_ping_interval | конвар | — | How often to flush raknet stats per second |
| profile.profiling_ping_per_frame | конвар | — | |
| profile.profiling_rcon | конвар | — | 0 = off, 1 = count per frame, 2 = connection attempts, 3 = messages |
| profile.profiling_rcon_message_length | конвар | — | Clamp the length of logged RCON messages to prevent the profiler from being flooded with large messages |
| profile.profiling_work_queue | конвар | — | Record execution time of ObjectWorkQueues per frame |
| profile.quiet | конвар | False | Controls whether perfsnapshot commands emit chat messages |
| profile.rcon_lagspike_threshold | конвар | — | |
| profile.resetexportinterval | команда | — | Resets the profiler export interval timer, causing the next export to happen after a full ExportIntervalS from now |
| profile.rpc_lagspike_threshold | конвар | — | |
| profile.runtime_profiling | конвар | 0 | 0 = off, 1 = basic, 2 = everything. This will reset all profiling convars, however they can be modified afterwards |
| profile.runtime_profiling_interval | конвар | 60 | |
| profile.runtime_profiling_persist | конвар | False | Enable to allow runtime profiling to persist across restarts |
| profile.runtime_profiling_pool_flush_interval | конвар | 300 | How often to flush pooling stats in seconds |
| profile.runtime_profiling_pooling | конвар | — | 0 = off, 1 = flush every 5 minutes |
| profile.start | команда | — | Starts recording a Unity Profiler binary log to a timestamped file in the profile/ folder; requires ENABLE_PROFILER build flag |
| profile.stop | команда | — | Stops the active Unity Profiler binary log recording and finalises the file |
| profile.stopwatchingallocs | команда | — | Stops tracking of allocations |
| profile.watchallocs | команда | — | Params: [Name = 'Allocs'] [maxStackDepth = 16].
Starts tracking of allocs, dumping a [Name].json.gz record once conditions are met |
| projectile.preventcameraclip | конвар | True | Should the projectile model attempt to prevent itself being clipped by the camera? |
| projectile.preventcameraclipbufferseconds | конвар | 0.01 | Buffer seconds before turning back on the projectile model. |
| projectile.serverprojectilecameraclipdistance | конвар | 0.3 | Distance before turning back on the server spawned projectiles model. |
| rabbit.population | конвар | 2 | Population active on the server, per square km |
| radiation.materialtoradsratio | конвар | 0.0044 | Multiplier converting radiation material value to effective radiation damage rate; lower values reduce radiation intensity globally |
| radiation.water_inventory_damage | конвар | True | When enabled, radiation-contaminated water damages items in a player's inventory over time when in a radiation zone |
| radiation.water_loot_damage | конвар | True | When enabled, radiation-contaminated water damages loot containers over time when exposed to sufficient radiation |
| rcon.ban_ip | команда | — | Ban an IP address from RCON, preventing it from connecting and kick any clients from this IP, this is permanent and persistent |
| rcon.banduration | конвар | 300 | How long in seconds to ban an IP that has exceeded the maximum password failures (default: 300 seconds) |
| rcon.clear_rcon_failed_logins | команда | — | Clear all failed login attempts |
| rcon.connectioncooldown | конвар | 1 | How long (in seconds) before we allow another rcon connection from the same address (default: 1 second) |
| rcon.ip | конвар | | IP Address to listen for RCON connections |
| rcon.logfailedattempts | конвар | True | Log failed attempts and attempts from banned IP addresses (default: true) |
| rcon.maxconnections | конвар | 500 | Total number of allowed connections to RCON server. -1 to disable behaviour. Requires server restart after changes |
| rcon.maxconnectionsperip | конвар | 5 | Total number of allowed connections to RCON server, on a single IP. -1 to disable behaviour. Requires server restart after changes |
| rcon.maxpasswordfailures | конвар | 5 | How many password failures before banning an RCON client's IP (default: 5) |
| rcon.permanentbanfailedips | конвар | False | Permanently ban IPs that trigger too many failed attempts (default: false) |
| rcon.port | конвар | 0 | Port to listen for RCON connections |
| rcon.print | конвар | False | If true, RCON commands will be printed in the console |
| rcon.print_rcon_bans | команда | — | Print a table of permanently banned IPs and networks. Use '--json' to return a JSON object |
| rcon.print_rcon_clients | команда | — | Print a table of connected RCON clients. Use '--json' to return a JSON object |
| rcon.print_rcon_failed_logins | команда | — | Print a table of clients with failed passwords. Use '--json' to return a JSON object |
| rcon.unban_ip | команда | — | Unban an IP address from connecting to RCON, will also remove all attempt history |
| rcon.web | конвар | True | If set to true, use websocket RCON. If set to false use legacy, source engine RCON. Source engine RCON is DEPRECATED |
| reclaimmanager.reclaim_expire_minutes | конвар | 120 | Time in minutes after which an uncollected softcore death reclaim backpack expires and its contents are destroyed |
| recordertool.debugrecording | конвар | — | When enabled, logs additional debug info about cassette recording state and audio buffer operations; saved between sessions |
| relationshipmanager.acceptinvite | команда | — | |
| relationshipmanager.addtoteam | команда | — | Adds the calling player to their existing team, creating the team entry if needed |
| relationshipmanager.contacts | конвар | true | |
| relationshipmanager.createandaddtoteam | команда | — | Creates a new team with the calling player and adds the specified player (by UID) to it; returns status string |
| relationshipmanager.fakeinvite | команда | — | Sends a fake team invite from the given team ID to the calling player; used for testing team invite UI flow |
| relationshipmanager.forceaddtoteam | команда | — | Adds a player to a team whether they are on the server or not |
| relationshipmanager.forgetafterminutes | конвар | 960 | Time in minutes after which relationship/contacts data for players who have not been seen is forgotten and removed |
| relationshipmanager.kickmember | команда | — | |
| relationshipmanager.leaveteam | команда | — | |
| relationshipmanager.maxplayerrelationships | конвар | 128 | Maximum number of relationship entries (contacts) each player can store; older entries are evicted when the limit is reached |
| relationshipmanager.maxteamsize | конвар | 8 | Maximum number of players allowed in a single team; 0 = teams disabled; changing this at runtime updates all active teams |
| relationshipmanager.mugshotupdateinterval | конвар | 300 | Interval in seconds between mugshot (contact portrait) refresh attempts for known players |
| relationshipmanager.promote | команда | — | |
| relationshipmanager.promote_id | команда | — | |
| relationshipmanager.rejectinvite | команда | — | |
| relationshipmanager.seendistance | конвар | 10 | Distance in metres within which two players must be for a 'seen' relationship event to be recorded |
| relationshipmanager.sendinvite | команда | — | |
| relationshipmanager.sendofflineinvite | команда | — | |
| relationshipmanager.sleeptoggle | команда | — | Toggles the sleep/wake state of the entity the calling admin player is looking at (within 5m); admin-only |
| relationshipmanager.trycreateteam | команда | — | Creates a new team with the calling player as leader; fails if teams are disabled (maxTeamSize == 0) |
| relationshipmanager.wipe_all_contacts | команда | — | Wipes all relationship contacts data for every player on the server; admin-only |
| relationshipmanager.wipecontacts | команда | — | Wipes all relationship contacts data for the calling player |
| relay.cfg_autoreconnect | конвар | — | If enabled, Rust Relay will automatically attempt to reconnect when the WebSocket connection drops |
| relay.cfg_encryptpackets | конвар | — | Sets whether packets should be encrypted when sent to the Rust Relay server, changing this will STOP the Rust Relay feature (restart with relay.restart) |
| relay.cfg_fakeplayer | конвар | — | If enabled, Rust Relay spawns a fake invisible player and only relays packets sent to that player, changing this will STOP the Rust Relay feature (restart with relay.restart) |
| relay.cfg_filtermode | конвар | — | Sets the Filter Mode for RPC Messages, (0 = Ignore, 1 = AllowAll, 2 = AllowWhitelist) |
| relay.cfg_maxreconnects | конвар | — | Maximum number of reconnect attempts allowed within the reconnect window before the relay permanently shuts down |
| relay.cfg_reconnectdelay | конвар | — | Delay (in seconds) between reconnect attempts |
| relay.cfg_reconnectwindow | конвар | — | The rolling window (in minutes) used to track reconnect attempts |
| relay.cfg_reload | команда | — | Reloads the Rust Relay configuration from disk, this will STOP the Rust Relay feature (restart with relay.restart) |
| relay.cfg_save | команда | — | Forces a save of the Rust Relay configuration to disk |
| relay.cfg_sendconsoledata | конвар | — | If enabled, console data will be sent to the relay server |
| relay.cfg_sendvoicedata | конвар | — | If enabled, voice data will be sent to the relay server |
| relay.cfg_server_auth_token | конвар | — | Sets the authentication token for the Rust Relay server, changing this will STOP the Rust Relay feature (restart with relay.restart) |
| relay.cfg_server_url | конвар | — | Sets the URL for the Rust Relay server, changing this will STOP the Rust Relay feature (restart with relay.restart) |
| relay.clear_queue | команда | — | Clears the relay send queue (useful if things are going wrong with the relay server) |
| relay.reconnect_reset | команда | — | Clears the reconnect attempt history, resetting the reconnect budget |
| relay.restart | команда | — | Attempts to restart the Rust Relay connection (may cause short lag) |
| relay.rpc_whitelist_add | команда | — | Adds an RPC Message to the RPC Whitelist |
| relay.rpc_whitelist_rebuild | команда | — | Rebuilds the RPC Whitelist ID List |
| relay.rpc_whitelist_remove | команда | — | Removes an RPC Message from the RPC Whitelist |
| relay.shutdown | команда | — | Shutsdown the Rust Relay sever connection |
| relay.status | команда | — | Returns a detailed Rust Relay status report |
| render.building_blocked_preview_distance | конвар | 100 | Distance from the border of building blocked to show the red preview |
| render.computebuffer_setdata_immediate | конвар | True | Whether to call ComputeBuffer.SetData immediately or at the end of the frame |
| render.expand_instancing | команда | — | Forces GPU instancing to expand and rebatch a specific instancing group by name; useful for debugging instancing issues without restarting |
| render.instanced_rendering | конвар | 0 | 0 = off, 1 = on (must restart client for changes to take effect) |
| render.instanced_toggle_all | конвар | True | Developer command to toggle instanced rendering at runtime to measure performance impact |
| render.instanced_toggle_buildings | конвар | True | Toggle rendering of buildings on / off |
| render.instanced_toggle_cliffs | конвар | True | Toggle rendering of cliffs on / off |
| render.instanced_toggle_other | конвар | True | Toggle rendering of uncategorized meshes on / off |
| render.instancing_render_distance | конвар | 1000 | Max distance for instanced rendering, can be higher than normal render distance |
| render.max_renderers | конвар | 0 | Set the amount of instanced renderers to show for debugging |
| render.multidraw | конвар | True | Allow unity to batch together multiple draw calls |
| render.print_global_entities | команда | — | Print off count of global building entities on the client |
| render.print_instanced_cell | команда | — | Print number of meshes inside a single grid |
| render.print_instanced_debug | команда | — | Print off array size and memory usage to ensure no memory leaks & debug rendering system |
| render.print_instanced_renderers | команда | — | Print off number of each mesh inside instanced rendering system (including outside of render range) |
| render.print_tree_counts | команда | — | Print off count of trees to ensure server sent them all |
| render.render_shadows | конвар | True | Enables or disables shadow rendering globally on the client; disabling shadows significantly improves GPU performance |
| render.show_building_blocked | конвар | True | Shows a coloured overlay on building-blocked areas client-side, visualising where construction is prevented |
| render.show_building_blocked_server | конвар | True | |
| render.test_instancing_culling | команда | — | Spawn (default 50k) prefabs spread across the map to quickly test instanced rendering system in isolation |
| render.upload_multidraw_meshes_mode | конвар | 0 | 0 = CPU, 1 = GPU |
| rentableshop.additionalchecktimehoursdebug | конвар | 0 | When checking the time to see if items need to be deleted, add this many hours to what it thinks the current time is |
| rentableshop.closenearestshop | команда | — | Close the nearest shop in 10m. Useful for testing |
| rentableshop.initialscrapfee | конвар | 100 | |
| rentableshop.maxstoreditemsdurationminutes | конвар | 1440 | How long stores should store items (after a shop is closed) for before they are destroyed |
| rentableshop.processrenttick | команда | — | |
| rentableshop.protectionfromtakeoverhours | конвар | 6 | |
| rentableshop.randomiseownerofnearestshop | команда | — | Randomise the owner of the nearest shop in 10m. Useful for testing |
| rentableshop.resettakeoverprotectionofclosestshop | команда | — | Reset the takeover protection duration of nearest shop. Useful for testing |
| rentableshop.scrapperhourrent | конвар | 10 | |
| reports.exceptionreportmaxlength | конвар | 600 | Maximum character length of exception reports submitted to the crash reporter; clamped to a minimum of 250 characters |
| rgbeffects.brightness | конвар | 1 | Brightness of colors, from 0 to 1 (note: may affect color accuracy) |
| rgbeffects.colorcorrection_razer | конвар | — | Controls how RGB values are mapped to LED lights on Razer devices |
| rgbeffects.colorcorrection_steelseries | конвар | — | Controls how RGB values are mapped to LED lights on SteelSeries devices |
| rgbeffects.enabled | конвар | True | Enables RGB lighting effects (supports SteelSeries and Razer) |
| rgbeffects.pulse | команда | — | Pulses all RGB lighting devices to a given colour over the specified duration in seconds; uses the RGB controller pulse animation |
| rgbeffects.static | команда | — | Sets all RGB lighting devices to a static colour; takes an RGBA colour argument and applies it to the RGB controller instance |
| rhib.rhibpopulation | конвар | — | Population active on the server |
| ridablehorse.autoavoidance | конвар | True | When enabled, horses use automatic avoidance steering to navigate around obstacles; saved between sessions; admin configurable |
| ridablehorse.debug | конвар | False | When enabled, draws debug visualisations for this system (seismic sensor range sphere, escape capture state, etc.); editor/admin-only |
| ridablehorse.decayminutes | конвар | 180 | How long before a horse dies unattended |
| ridablehorse.dungtimescale | конвар | 1 | Scale all rideable animal dung production rates by this value. 0 will disable dung production. |
| ridablehorse.groundangleupdaterate | конвар | 0.05 | Interval in seconds between ground angle recalculation updates for horse body tilting; default 0.05s |
| ridablehorse.population | конвар | 2 | Population active on the server, per square km |
| ridablehorse.ragdoll | команда | — | Ragdolls the ridable horse entity directly in front of the calling admin player; useful for testing horse physics and death states |
| ridablehorse.setforsale | команда | — | Marks the horse directly in front of the calling admin player as for-sale, enabling the purchase interaction |
| ridablehorse.sethorsebreed | команда | — | Sets the breed index of the horse directly in front of the calling admin player to the given integer value |
| ridablehorse.throttledgroundangleupdate | конвар | 1 | When enabled, ground angle updates for horse body tilt are throttled to groundAngleUpdateRate seconds; improves performance |
| room.draw_faces | команда | — | Draws the face outlines and closest-face links of the building block you are looking at and everything connected to it (breadth-first walk). Args: [duration=10] [range=40]. |
| room.draw_live | конвар | False | Continuously draw the room partition around every player, refreshing as the base changes. Needs room.occlusion on (1 = shadow mode draws without hiding anything). Editor/dev tool - it redraws for everyone connected, so do not leave it on. |
| room.draw_live_normals | конвар | True | Draw the normal arrows and face outlines of the room.draw_live overlay (off = room-coloured outlines only, much less traffic) |
| room.draw_live_range | конвар | 30 | Radius of the room.draw_live overlay, in metres |
| room.draw_networkgroups | команда | — | Draws room contents and boundary network groups for the building you are looking at. Green = subscribed, yellow = held but awaiting subscription, red = not held, grey = positional grid. Args: [duration=10] [range=40]. |
| room.draw_networkgroups_live | конвар | False | Continuously draw room contents, boundary groups and portal subscription state around every player. Needs room.occlusion on. Editor/dev tool - do not leave it on. |
| room.draw_portals | команда | — | Draws the portals of the building you are looking at (green = open, red = closed) |
| room.draw_rooms | команда | — | Draws the faces of the building you are looking at coloured by room. Args: [duration=10] [range=40]. Outside room is dim white; arrows point into the room each face borders. |
| room.draw_visible | команда | — | Draws the faces of every room you can see into from where you stand (green), and the rooms you cannot (red) |
| room.exportbase | команда | — | Editor-only: exports the current room partition to RoomFixtures/<name>.json so it can be replayed offline in the edit-mode tests. Pass a name; defaults to 'capture'. To capture a base from a live server, copypaste it into an editor server first. |
| room.exportpastes | команда | — | Editor-only: pastes every .data file in a directory one at a time and exports each to RoomFixtures/<folder>/<paste>.json for the edit-mode fixture tests. Args: <directory> [folder=directory name]. Pastes that already have a fixture are skipped. |
| room.occlusion | конвар | 0 | Server-side interior occlusion: 0 = off, 1 = shadow mode (compute + log, hide nothing), 2 = enforce |
| room.occlusion_admin_bypass | конвар | True | Admins and developers bypass interior occlusion and see everything |
| room.occlusion_deployables | конвар | 1 | What interior occlusion hides inside a room: 0 = nothing (building blocks only), 1 = static entities (boxes, workbenches, beds), 2 = also IO entities (wires and pipes can be dragged to an entity that is not on your client) |
| room.occlusion_door_immediate | конвар | True | Kill switch for the whole synchronous pre-open pass: repartition and deliver the rooms behind a door the moment it opens, instead of leaving it to the normal budgeted queue. Only players within room.occlusion_door_immediate_range are flushed; further ones enqueue as usual. Off skips the repartition entirely, not just the flush. |
| room.occlusion_door_immediate_range | конвар | 30 | How close a player must be to a door for its rooms to be sent immediately when it opens, in metres. 0 = no limit, flush every viewer of the door. |
| room.occlusion_linger | конвар | 5 | How long a room must have been out of sight before it is dropped from a player's client, in seconds. Stops a door being opened and shut, or a walk past a doorway, from destroying and re-sending a whole room. 0 = drop immediately. |
| room.occlusion_nearby_range | конвар | 32 | Rooms within this many metres of a player are always sent, whether or not they can see into them. Leaving the radius starts the room.occlusion_linger countdown rather than dropping it at once. 0 = only ever send what is actually visible. |
| room.occlusion_range | конвар | 250 | How far from a player interior occlusion looks for rooms to hide things in, in metres. Must comfortably exceed network range; rooms beyond it fail open. |
| room.occlusionstats | команда | — | Prints interior occlusion's shadow-mode report: how much of the world ended up effectively outside (fail open) and how much each player has hidden |
| room.printfaces | команда | — | Prints the closest-face link of every edge on the building block you are looking at. Pass --ddraw to also draw the links. |
| room.printhidden | команда | — | Prints which interior rooms a player can currently see into, i.e. which room network groups they hold. Defaults to yourself. |
| room.printportals | команда | — | Prints every portal of the building you are looking at (rooms joined, filler, open state) |
| room.printrooms | команда | — | Prints the room partition of the building you are looking at |
| room.printvisible | команда | — | Prints the room a player is standing in and every room they can see into. Defaults to yourself. |
| rustnav.addtilebudgetms | конвар | 2 | Main-thread time budget per frame (ms) for adding built navmesh tiles to their navmesh. A base rebuild lands dozens of results in one frame and the rest waits for the next one. 0 or less adds every result that is ready, which is what shipped before the budget existed |
| rustnav.bakestats | команда | — | Print accumulated navmesh bake statistics. Pass true to reset them instead |
| rustnav.bakestatsenabled | конвар | — | Collect navmesh bake statistics (rustnav.bakestats to read them). Defaults on in the editor, off on servers; flip on live to diagnose bake issues, then reset with rustnav.bakestats true |
| rustnav.collectbudgetms | конвар | 1 | Main-thread time budget per frame (ms) for navmesh tile geometry collection. The full-map bake wall clock is roughly tiles / (budget-worth of tiles per frame) / fps, so raise this while baking to trade frame time for bake speed |
| rustnav.debugload | команда | — | |
| rustnav.debugpath | команда | — | |
| rustnav.debugraycast | команда | — | |
| rustnav.debugrebuildtile | команда | — | |
| rustnav.debugsample | команда | — | |
| rustnav.debugsave | команда | — | |
| rustnav.detailsampledistmult | конвар | 12 | Detail mesh sample distance as a multiple of cellSize (Recast default 6). Larger = cheaper detail mesh, coarser surface height. Applies to tiles built after the change |
| rustnav.detailsamplemaxerrormult | конвар | 1 | Detail mesh max sample error as a multiple of cellHeight (Recast default 1). Larger = cheaper detail mesh, more height error. Applies to tiles built after the change |
| rustnav.doorreassertspertick | конвар | 24 | How many doors re-assert their gate state per navmesh drain tick. A rebuilt tile bakes its apertures shut, so every open or npc-openable door over the rebuilt area has to write its state again, and a megabase queues hundreds of them at once. 0 or less applies the whole queue in one frame, which is what shipped before the budget existed |
| rustnav.draw | команда | — | |
| rustnav.drawkbps | конвар | 512 | Max KB per second of navmesh tiles streamed to each rustnav.draw viewer |
| rustnav.drawmanifestinterval | конвар | 10 | |
| rustnav.drawradius | конвар | 100 | |
| rustnav.drawrefreshrate | конвар | 0.25 | |
| rustnav.dumptilegeo | команда | — | Rebuild one default-navmesh tile synchronously and dump its assembled geometry + heightfield bounds to a file for the offline native-build harness: rustnav.dumptilegeo <tx> <ty> <path> |
| rustnav.enableverboselogs | конвар | False | |
| rustnav.legacybuild | конвар | False | A/B kill switch: build navmesh tiles with the stock pre optimization algorithms (clip rasterizer, full ledge and region rescans, unfused filters). Combine with detailsampledistmult 6 to approximate the old build end to end. Applies to tiles built after the change |
| rustnav.maxshoredistance | конвар | 100 | Metres of open water past which default navmesh tiles are dropped instead of baked. A tile only drops when every point in it is that far from land, so shores keep their navmesh and so do rivers and lakes, which are never that wide. Independent navmeshes (oilrigs, tropical islands, ghost ships) are never touched. 0 or less bakes the open sea like before. Applies to tiles queued after the change |
| rustnav.navmeshstats | команда | — | List every navmesh (default + independent monuments/islands/ghostships) ranked by accumulated worker build time |
| rustnav.numthreads | конвар | 4 | Navmesh tile builder worker thread count. Applied when the builder is (re)created - at boot, or via rustnav.setnumthreads at runtime. ~half the cores is the sweet spot for full-map bakes |
| rustnav.rebuild | команда | — | |
| rustnav.savecompression | конвар | True | LZ4-compress navmesh saves (smaller .navmesh files, no extra save time) |
| rustnav.savedelta | конвар | True | Append only the tiles that changed to the navmesh file instead of rewriting all of it. The first save after a boot or a rebuild is always a full write, and a full write also happens once the appended part grows past rustnav.savedeltabudget |
| rustnav.savedeltabudget | конвар | 0.5 | How large the appended part of the navmesh file may grow, as a fraction of the full file, before the next save rewrites the whole thing. A save whose changed tiles are a larger share of the mesh than this rewrites it too. Bounds both file growth and boot load time. 0 or less removes the bound, to stop appending altogether use rustnav.savedelta false |
| rustnav.savethreads | конвар | 0 | Worker threads for navmesh save/load compression. 0 = auto |
| rustnav.savewarnms | конвар | 1000 | Log the navmesh save completion line as a warning past this many milliseconds. 0 or less never warns |
| rustnav.setnumthreads | команда | — | |
| sail.maxthrustmultiplier | конвар | 1 | |
| samsite.autoreloaddelay | конвар | 45 | Delay before SAM sites that haven't shot a target will auto-reload |
| samsite.staticrepairseconds | конвар | 1200 | how long until static sam sites auto repair |
| santasleigh.altitudeaboveterrain | конвар | 50 | |
| santasleigh.desiredaltitude | конвар | 60 | |
| santasleigh.drop | команда | — | |
| satellite.control_window | конвар | 180 | Seconds of thruster control window |
| satellite.cooldown_hours_max | конвар | 18 | Maximum cooldown between satellite events, in game hours |
| satellite.cooldown_hours_min | конвар | 18 | Minimum cooldown between satellite events, in game hours (not real minutes) — converted to real time via the map's day length, same as the airdrop event scheduler. |
| satellite.crashing_fx_at_distance | конвар | True | Run the crashing FX pass (FX Pass 3) through the whole phase-2 descent, including the distance-projected stretch, instead of waiting until the satellite enters real draw distance. The projected-mode fixup still applies — its particles simulate in local space and scale with the model; its trails stay gated until real rendering. |
| satellite.crate_fire_duration | конвар | 300 | Seconds the crash loot crates burn and stay unlootable after impact. All crates unlock together when this expires. |
| satellite.debug | конвар | False | Log crash-target search diagnostics (samples, blockers, reasons) |
| satellite.default_crash_radius | конвар | 300 | Starting impact radius before thruster adjustments, in meters |
| satellite.descent_angle | конвар | 45 | Angle (degrees from vertical) the satellite descends at. Higher = more horizontal streak across the sky. Clamped to 45 so it always reaches the ground within 45 degrees of straight down. Only used when flyover_altitude is 0 — the flyover path has its own geometry. |
| satellite.descent_seconds | конвар | 600 | Descent duration in seconds (0 = use day length fraction; nonzero values are clamped to a minimum of final_descent_seconds so the phase-2 window always fits inside the descent) |
| satellite.final_descent_seconds | конвар | 300 | Seconds before the scheduled crash that the satellite begins its phase-2 physics descent. Phase 1 slides in to the phase-2 start point up until then, then the satellite drops at a speed timed to hit the ground exactly on schedule. The start point is placed at the satellite's finalDescentSpeed times this window, so lengthening it starts the descent higher rather than slowing the fall. |
| satellite.final_descent_speed | конвар | 0 | Speed (m/s) of the phase-2 physics descent (0 = use the satellite prefab's finalDescentSpeed). Together with final_descent_seconds this sets where phase 2 starts — speed times seconds back up the descent line — so e.g. 180s at 80 m/s starts the drop 14.4km out. |
| satellite.flyover_altitude | конвар | 2500 | Altitude (m above the crash target) of the phase-2 flyover cruise. The satellite enters near-horizontally at this height, streaks across the sky, then bends into a dive onto the target from flyover_dive_distance out. 0 = disable the flyover and use the legacy straight-line descent at descent_angle. |
| satellite.flyover_dive_distance | конвар | 1500 | Horizontal distance (m) from the crash target at which the flyover bends into its terminal dive. Smaller = a longer level cruise with a steeper final plunge. |
| satellite.free_fuel | конвар | False | If true, firing satellite thrusters does not consume fuel |
| satellite.free_power | конвар | False | If true, powering up the satellite computer does not require any items |
| satellite.fuel_large_max | конвар | 16 | Maximum fuel rolled for large satellites (3000-5000kg) |
| satellite.fuel_large_min | конвар | 10 | Minimum fuel rolled for large satellites (3000-5000kg) |
| satellite.fuel_max | конвар | 36 | Hard maximum on generated fuel, applied after the per-size roll regardless of size |
| satellite.fuel_medium_max | конвар | 26 | Maximum fuel rolled for medium satellites (1500-3000kg) |
| satellite.fuel_medium_min | конвар | 16 | Minimum fuel rolled for medium satellites (1500-3000kg) |
| satellite.fuel_min | конвар | 8 | Hard minimum on generated fuel, applied after the per-size roll regardless of size |
| satellite.fuel_small_max | конвар | 36 | Maximum fuel rolled for small satellites (500-1500kg) |
| satellite.fuel_small_min | конвар | 24 | Minimum fuel rolled for small satellites (500-1500kg) |
| satellite.initial_offset_attempts | конвар | 8 | How many times to re-roll the initial random map position, re-checking the full crash-site acceptance each time, until a valid starting target is found. Guarantees the control phase never starts on an unusable spot. |
| satellite.kill_radius | конвар | 10 | Radius (m) around the impact point cleared on crash — players killed, construction/deployables/vehicles destroyed, vegetation removed |
| satellite.lateral_distance | конвар | 200 | Lateral offset multiplier per thruster fire (meters) |
| satellite.launch | команда | — | Dev: search for a safe crash site around the calling player using the exact same acceptance checks a control computer's lock-in uses (topology, water, unevenness, safezones, obstructions), then launch the full orbital descent there. Not a full session replica: searches around the player rather than a computer's semi-random targeting center, always does a fresh scan (no thruster-history reuse), and has no owning computer (no countdown screen, radius floor still enforced, no-build volume self-despawns after impact instead of being computer-managed): satellite.launch [radius] |
| satellite.launchquick | команда | — | Dev: exactly satellite.launch — same crash-site search and validation — but skips the wait: the satellite spawns already in phase 2, 30 seconds from impact, at the point of the descent path it would normally reach then: satellite.launchquick [radius] |
| satellite.min_crash_radius | конвар | 100 | Minimum crash radius in meters |
| satellite.nudge_distance_max | конвар | 150 | Maximum random aim drift (meters) applied when tightening the impact radius |
| satellite.nudge_distance_min | конвар | 100 | Minimum random aim drift (meters) applied when tightening the impact radius, at a fully random angle so it can't be cancelled out exactly by the cardinal-direction lateral thrusters |
| satellite.obstruction_tc_reorder | конвар | True | Crash targeting: use the tool-cupboard grid to test likely-occupied samples last, so a clear spot is usually found with fewer physics checks. The physics check stays authoritative. |
| satellite.phase1_extra_distance | конвар | 30000 | Extra distance (m) further out, along the descent line, that phase 1 starts. The satellite slides steadily from there in to the orbit point over phase 1, then phase 2 continues along the same line. |
| satellite.phase1_grow_scale | конвар | 4 | Multiplier the orbiting satellite's glow billboard grows to by the end of phase 1 (starts at 1x). Purely a visual telegraph; replicated because the grow runs client-side. |
| satellite.random | команда | — | Trigger a satellite crash at a random valid position on the map |
| satellite.require_powerplant | конвар | True | If true, the satellite control computer can only be powered up while the power plant is active (powergrid stage 1+). Ignored when the powergrid system itself is disabled. |
| satellite.reuse_last_crash_spot | конвар | True | Crash targeting: before scanning, re-test the previously found crash spot. Small thruster nudges usually leave it valid, returning in a single check. |
| satellite.rotation_strength | конвар | 15 | Heading rotation per thruster fire (degrees) |
| satellite.shrink_expand_radius | конвар | 25 | Impact radius change per thruster fire (meters) |
| satellite.site_check_physical_geometry | конвар | True | Also raycast the crash-site footprint against real collision geometry, rejecting spots with rocks or scenery the heightmap can't see |
| satellite.site_clearance_radius | конвар | 16 | Clearance (m) the crash-site search demands around a candidate — rejected if any player building, prevent-building volume or safezone is within this range. Kept separate from kill_radius so targeting standoff can exceed what the impact destroys; 16 matches the building-privilege radius, so a valid site is never inside a base's TC influence. |
| satellite.site_footprint_radius | конвар | 15 | Radius (m) around a candidate crash spot sampled for ground shape — roughly the crash remains footprint. Used both to reject unsuitable spots and to fit the spawned remains to the ground. |
| satellite.site_max_slope | конвар | 25 | Max overall ground slope (degrees) across the crash footprint before a spot is rejected |
| satellite.site_max_unevenness | конвар | 2 | Max terrain height deviation (m) from the crash footprint's best-fit plane before a spot is rejected as too uneven (cliff edges, crests, dips the remains meshes can't hide) |
| satellite.sky_trail | конвар | True | Render the satellite's descent as a map-wide sky ribbon tracing the real flight path, visible from any distance at any draw distance setting. Rendered client-side from the entity's networked positions. |
| satellite.sky_trail_age_fade | конвар | True | Fade each point of the sky ribbon out over its lifetime (sky_trail_seconds), like a TrailRenderer — the streak continuously dissolves behind the satellite instead of holding full brightness until its points expire. |
| satellite.sky_trail_drain_seconds | конвар | 10 | Seconds the sky ribbon takes to drain away tail-first after the satellite crashes or is destroyed. The recorded point ages are compressed into this window, so the ribbon keeps shrinking exactly the way it does in flight, and the impact end of the streak is the last to go. |
| satellite.sky_trail_max_length | конвар | 0 | Maximum length of the sky ribbon in meters of flight path — the tail is trimmed to keep the ribbon at or under this. 0 = no length cap, letting the sky_trail_seconds lifetime fade own the tail instead of a hard cut. |
| satellite.sky_trail_noise | конвар | 1 | Meters of smooth random wobble baked into the sky ribbon as it's laid down, so the streak reads as turbulent rather than a perfect straight line. Keep it under the dish's size (~3m) or the trail visibly detaches from the model. 0 = perfectly straight. |
| satellite.sky_trail_seconds | конвар | 60 | Seconds of flight path the sky ribbon spans — its TrailRenderer-style lifetime: with sky_trail_age_fade on, points dissolve to nothing as they reach this age. Capped by the ribbon's internal point budget at ~128s. |
| satellite.sky_trail_width_degrees | конвар | 0.075 | On-screen thickness of the sky ribbon's head, in degrees of view angle — it holds the same apparent width whatever distance it's projected at, tapering to a point at the tail. |
| satellite.targeting_budget_ms | конвар | 5 | Crash targeting: max milliseconds per frame spent scanning for a safe crash site. The scan resumes next frame when exceeded. |
| satellite.targeting_coverage_factor | конвар | 3 | Crash targeting: candidate samples tested per clearance-footprint, i.e. per (targetingRadius/clearanceRadius)^2. The sample count scales with the targeting area, so a small circle runs far fewer checks than a large one. ~1.2 is bare geometric coverage (samples spaced ~one clearance apart); the default adds margin to catch tight gaps. Pushing it much higher mostly adds correlated, redundant checks. |
| satellite.targeting_min_samples | конвар | 8 | Crash targeting: minimum candidate samples per search, regardless of how small the targeting circle is. Floors the area-scaled sample count so a small but cluttered area still gets a fair number of attempts. |
| satellite.thruster_extra_steps | конвар | 2 | When a thruster move finds no valid crash site, how many extra steps to take in the same direction before giving up. Fuel cost is linear in the number of steps taken (a 3-step move costs 3 fuel), and a further step isn't attempted if the player can't afford it. |
| satellite.thruster_module_count | конвар | 3 | Thruster modules salvaged from fully harvesting the crash remains |
| satellite.thruster_module_min_condition | конвар | 0.2 | Minimum condition fraction of salvaged thruster modules, regardless of how much fuel the satellite burned before lock-in |
| satellite.trail_alpha_scale | конвар | 1 | Multiplier on the alpha of the satellite trails' authored colour gradients, saturating at full opacity — the authored fades drop to near-transparent within the first quarter of the trail, so values above 1 keep progressively more of its length visible. Applied alongside trail_time_scale as the trails switch on. |
| satellite.trail_time_scale | конвар | 1 | Multiplier on the authored lifetime of the satellite's trail renderers — a trail spans this many times the authored seconds of flight path, so it directly scales the visible streak length. Applied as the trails switch on (they sit out the projected far-distance stretch and only run once the satellite is drawn at its real position), so changes take effect at the next handover, not mid-trail. Replicated because trails render client-side. |
| satellite.trigger | команда | — | Trigger a satellite crash at the calling player's position or optional coordinates, with an optional satellite mass (kg) driving loot like a computer-controlled crash: satellite.trigger [mass] or satellite.trigger [x z [mass]] |
| satellite.wreck_fire_duration | конвар | 480 | Seconds the main wreck stays too hot to harvest after impact |
| scraptransporthelicopter.population | конвар | — | Population active on the server |
| searchlight.debugvolumetrics | конвар | — | |
| seaturtle.forcesurfaceamount | конвар | 0 | |
| seaturtle.population | конвар | 2 | Population active on the server, per square km |
| sensecomponent.maxrefreshintervalseconds | конвар | 1 | |
| sensecomponent.minrefreshintervalseconds | конвар | 0.2 | |
| sentry.debugpreventduplicates | конвар | True | Prevents auto turrets getting added more than once to the IO queue |
| sentry.hostileduration | конвар | 120 | how long until something is considered hostile after it attacked |
| sentry.interferenceradius | конвар | 40 | radius to check for other turrets |
| sentry.maxinterference | конвар | 12 | max interference from other turrets |
| sentry.scantimer | конвар | 1 | How quickly can a turret acquire a potential target. Less is faster, but perf taxing |
| sentry.targetall | конвар | False | target everyone regardless of authorization |
| server.allowsorting | конвар | True | Set to false to disable the storage adaptor sorting functionality |
| server.allowvineswinging | конвар | True | When true, players can grab and swing on deployed vines; disable to prevent vine-swinging movement |
| server.anticheatid | конвар | xyza7891h6UjNfd0eb2HQGtaul0WhfvS | Easy Anti-Cheat product ID used to authenticate this server with EAC services |
| server.anticheatkey | конвар | OWUDFZmi9VNL/7VhGVSSmCWALKTltKw8ISepa0VXs60 | Easy Anti-Cheat product key used alongside anticheatid for EAC server authentication |
| server.anticheatlog | конвар | — | Sets the EOS (Epic Online Services) anti-cheat log verbosity level; higher values produce more detailed anti-cheat diagnostic output |
| server.anticheattoken | конвар | True | When true clients must provide a valid EAC token to connect; disable only for testing or modded environments |
| server.arrowarmor | конвар | 1 | Global multiplier for armour effectiveness against arrow and bow damage; 1.0 = default |
| server.arrowdamage | конвар | 1 | Global multiplier for all arrow and bow damage dealt; 1.0 = default, 2.0 = double damage |
| server.artificialtemperaturegrowablerange | конвар | 4 | |
| server.authtimeout | конвар | 60 | Seconds an incoming connection has to complete authentication (Steam + EAC) before being forcibly disconnected |
| server.autouploadmap | конвар | True | Automatically upload procedurally generated maps so that players download them (faster) instead of re-generating them |
| server.autouploadmapimages | конвар | True | Automatically upload an image of the map, used to show the map in the server browser |
| server.backup | команда | — | Backup server folder |
| server.bag_quota_item_amount | конвар | True | |
| server.bansserverendpoint | конвар | | HTTP API endpoint for centralized banning (see wiki) |
| server.bansserverfailuremode | конвар | 0 | Failure mode for centralized banning, set to 1 to reject players from joining if it's down (see wiki) |
| server.bansservertimeout | конвар | 5 | Timeout (in seconds) for centralized banning web server requests |
| server.bleedingarmor | конвар | 1 | Global multiplier for armour effectiveness against bleeding damage; 1.0 = default |
| server.bleedingdamage | конвар | 1 | Global multiplier for all bleeding damage over time; 1.0 = default |
| server.botcount | команда | — | Returns the current number of bot (AI-controlled player) entities active on the server |
| server.broadcastplayvideo | команда | — | Sends a video URL to all connected players, causing the in-game video player to open and play the specified video on every client |
| server.bulletarmor | конвар | 1 | Global multiplier for armour effectiveness against bullet damage; 1.0 = default |
| server.bulletdamage | конвар | 1 | Global multiplier for all bullet damage dealt by firearms; 1.0 = default, 2.0 = double damage |
| server.bypassiteminputrestriction | конвар | False | Allows items to be moved into containers that block item input |
| server.canequipbackpacksinair | конвар | False | Allows backpack equipping while not grounded |
| server.ceilinglightgrowablerange | конвар | 3 | Radius in metres within which a ceiling light provides artificial light that counts toward a growable plant's light requirement |
| server.ceilinglightheightoffset | конвар | 3 | Vertical offset in metres added when checking whether a ceiling light illuminates a plant directly below it |
| server.censorplayerlist | конвар | True | Censors the Steam player list to make player tracking more difficult |
| server.cheatreport | команда | — | |
| server.cinematic | конвар | False | |
| server.clear_bushes_radius | команда | — | Kills all server-side bush entities within a given radius of the calling player (or a specified world position); args: radius [x y z] |
| server.clear_loot_spawn_cache | команда | — | Clears the loot spawn cache used to restrict loot into each era |
| server.clear_trees_radius | команда | — | Kills all server-side tree entities within a given radius of the calling player (or a specified world position); args: radius [x y z] |
| server.clearplayerreportcounts | команда | — | Clear the player reports list |
| server.combatlog | команда | — | Get the player combat log |
| server.combatlog_outgoing | команда | — | Get the player combat log, only showing outgoing damage |
| server.combatlogdelay | конвар | 10 | Seconds of delay before a combat event appears in the player's own combat log, preventing real-time tracking during a fight |
| server.combatlogsize | конвар | 30 | Number of recent combat events retained in each player's combat log, viewable with combatlog |
| server.compassenabled | конвар | True | Will the in-game compass show at the top of the screen |
| server.composterupdateinterval | конвар | 300 | How often (in seconds) composters advance their composting progress; default is every 300 seconds (5 minutes) |
| server.compression | конвар | — | Enables or disables network packet compression on the server; compression reduces bandwidth at the cost of a small amount of CPU time |
| server.conveyormovefrequency | конвар | 5 | How often industrial conveyors attempt to move items (value is an interval measured in seconds). Setting to 0 will disable all movement |
| server.corpsedespawn | конвар | 300 | Seconds before a player corpse is removed from the world; default is 300 seconds (5 minutes) |
| server.corpseinfo | команда | — | Get info on player corpses on the server |
| server.corpses | конвар | True | Whether player corpses are spawned when players die; disabling removes corpses entirely and items are dropped directly |
| server.crawlingenabled | конвар | True | Do players go into the crawling wounded state |
| server.crawlingmaximumhealth | конвар | 12 | Maximum initial health given when a player dies and moves to crawling wounded state |
| server.crawlingminimumhealth | конвар | 7 | Minimum initial health given when a player dies and moves to crawling wounded state |
| server.creamseparationhours | конвар | 4 | Hours milk has to spend in a refrigerated container before it can be skimmed. Items already chilled won't notice a change until their next network update |
| server.cycletime | конвар | 500 | Duration of a full day/night cycle in seconds; default 500s means roughly one cycle every 8 real-world minutes |
| server.debrisdespawn | конвар | 30 | Seconds before environmental debris entities (e.g. broken barrel remnants) are removed from the world; default 30 seconds |
| server.deepseafogofwar | конвар | True | Should the deep sea map be covered by fog of war |
| server.defaultblueprintresearchcost | конвар | 10 | How much scrap is required to research default blueprints |
| server.description | конвар | No server description has been provided. | Short description of the server shown to players in the server browser |
| server.destroytaskbatchcount | конвар | 128 | UsePlayerUpdateJobs 2 related - how many destroy messages to batch into 1 task |
| server.drawpuzzleresets | конвар | False | When enabled, debug spheres are drawn in the world showing the radiation zone boundaries during monument puzzle resets |
| server.dropitems | конвар | True | Whether items drop to the ground from a player's inventory when they die; disable to prevent item drops on death |
| server.eac_gameplay_data | конвар | True | Whether or not to send additional analytics to EAC |
| server.emojiownershipcheck | конвар | True | Whether emoji ownership is checked server side. Could be performance draining in high chat volumes |
| server.encryption | конвар | 2 | Network encryption mode; 2 = enabled (recommended), 0 = disabled |
| server.enforce_era_restrictions | команда | — | Deletes items on the server that are not allowed in the era |
| server.enforcepipechecksonbuildingblockchanges | конвар | True | Whether to check for illegal industrial pipes when changing building block states (roof bunkers) |
| server.entitybatchsize | конвар | 100 | Number of entities included in each entity-update batch per frame; tune to balance CPU time spent on entity processing |
| server.entitybatchtime | конвар | 1 | Time in seconds allocated to each entity batch update pass; the server will not start a new batch until this interval has elapsed |
| server.entityrate | конвар | 16 | How many times per second entity network state is sent to clients; higher values reduce perceived lag for moving objects |
| server.era | конвар | — | none,primitive,medieval,frontier,rust |
| server.events | конвар | True | Enables automatic server-side game events such as helicopter patrols, airdrops and cargo ship visits |
| server.explosive_testing_mode | конвар | False | Lower damage of explosives to 1 and allow them to be triggered multiple times |
| server.farmchickenlocalavoidance | конвар | True | Whether to run local avoidance for chickens, disabling might get a slight performance improvement but chickens will clip |
| server.favoritesendpoint | конвар | | Domain name to save when players favorite your server. The port can be omitted if using the default port or a SRV DNS record is created. |
| server.filefolderoverride | конвар | | Override the root storage folder for server files; leave empty to use the default server/identity path |
| server.filerequestbytesburst | конвар | 4194304 | Burst of requested file data bytes each client can be sent before further requests are deferred. Replicated so clients throttle their own requests to match |
| server.filerequestbytespersecond | конвар | 2097152 | Bytes per second of requested file data (sign textures, photos, cassette audio, sculpts) sent to each client; requests beyond this are deferred, not dropped. Replicated so clients throttle their own requests to match |
| server.filerequestdebug | конвар | False | Print file request rate limiting activity to the server console: incoming requests, bytes sent, and per-connection budget usage as it recovers over time |
| server.filerequestqueuelength | конвар | 256 | Maximum deferred file requests per client; requests beyond this are dropped (a legitimate client's own request throttle never fills the queue) |
| server.fillchickencoop | команда | — | Debug command: fills all chicken coops within 5 metres of the calling player to their maximum capacity |
| server.fogofwar | конвар | False | Should the in-game map be covered by a fog of war |
| server.fogofwarrevealsize | конвар | 256 | How much area around the player is revealed when using fog of war. Must be a multiple of 32 |
| server.foodspoiling | конвар | True | Whether to run the food spoiling system |
| server.foodspoilingbudgetms | конвар | 0.05 | Maximum milliseconds per frame the server spends advancing food spoil timers; lower values reduce frame time impact at the cost of less frequent spoil updates |
| server.fps | команда | — | Prints the current server frame rate in frames per second |
| server.funwaterdamagethreshold | конвар | 0.8 | |
| server.funwaterwetnessgain | конвар | 0.05 | |
| server.gamemode | конвар | — | Short name of the game mode to activate on this server (e.g. 'softcore', 'hardcore'); applies convar overrides defined by that game mode's prefab |
| server.hardcorefirearmammunitioncraftingmultiplier | конвар | 1 | Multiplies crafting cost of firearm ammunition |
| server.headerimage | конвар | | URL of the banner/header image shown at the top of this server's page in the server browser |
| server.hideplayermapdirection | конвар | False | Should hte player see their direction on the map |
| server.hideplayeronmap | конвар | False | Should the player see their position on the map |
| server.homingmissiletargetshab | конвар | False | If true hot air balloons can be shot down with homing missiles |
| server.hopperanimationbudgetms | конвар | 0.1 | How long per frame to spend animating items moving into the hopper (will be instant if <= 0) |
| server.hostname | конвар | My Untitled Rust Server | Server name displayed in the server browser |
| server.http_connection_limit | конвар | 32 | Maximum number of simultaneous outbound HTTP connections the server may have open at once; used for map uploads, ban checks, and other web requests |
| server.identity | конвар | my_server_identity | Unique identifier for this server instance; determines the subfolder used for saves, configs and map data |
| server.idlekick | конвар | 30 | Minutes of in-game inactivity before a player is automatically kicked; set to 0 to disable idle kick |
| server.idlekickadmins | конвар | 0 | Minutes of inactivity before admin players are idle-kicked; 0 disables idle kick specifically for admins regardless of idlekickmode |
| server.idlekickmode | конвар | 1 | Controls who is subject to the idle kick: 0 = nobody, 1 = non-admin players only, 2 = all players including admins |
| server.incapacitatedrecoverchance | конвар | 0.1 | Base chance of recovery after incapacitated wounded state |
| server.industrialallowquickmove | конвар | True | Enables a faster way to move items around during conveyor transfers. Should be on unless there's a issue |
| server.industrialcrafterfrequency | конвар | 5 | How often industrial crafters attempt to craft items (value is an interval measured in seconds). Setting to 0 will disable all crafting |
| server.industrialframebudgetms | конвар | 0.5 | How long per frame to spend on industrial jobs |
| server.industrialtransferstricttimelimits | конвар | True | When enabled industrial transfers will abort if they start to take too long. Will lead to inconsistent splitting but should retain performance |
| server.ip | конвар | | IP address the server binds to; leave empty to bind to all interfaces |
| server.ipqueriespermin | конвар | 30 | Maximum number of Steam server browser queries allowed per minute from a single IP address |
| server.itemdespawn | конвар | 300 | Seconds before items dropped on the ground despawn; default is 300 seconds (5 minutes) |
| server.itemdespawn_container_max_multiplier | конвар | 24 | Upper cap on the loot container despawn multiplier; at default 24 the maximum lifetime is 24 x 5 min = 2 hours |
| server.itemdespawn_container_scale | конвар | 2 | Multiplier applied to the base item despawn time for items sitting inside loot containers; default 2x extends their lifetime |
| server.itemdespawn_quick | конвар | 30 | Fast-despawn time in seconds used for short-lived dropped items such as empty casings or small debris; default 30 seconds |
| server.level | конвар | Procedural Map | Map level to load on startup, e.g. 'Procedural Map', 'Barren', or a custom map name |
| server.leveltransfer | конвар | True | When true the server sends the map file to clients so they can load it without re-generating it locally |
| server.levelurl | конвар | | URL to download a custom map file from; if set the server will fetch and load this map instead of generating one |
| server.listplayerreportcounts | команда | — | List the amount of reports players on the server have received |
| server.listtoolcupboards | команда | — | Prints all the Tool Cupboards on the server |
| server.listvendingmachines | команда | — | Prints all the vending machines on the server |
| server.log_invalid_packet_lengths | конвар | — | Logs network packets rejected for being empty or not byte-aligned |
| server.logoimage | конвар | | URL of the logo image shown for this server in the server browser |
| server.long_distance_sounds | конвар | True | When enabled, long-distance ambient sounds (e.g. distant gunfire) are networked to clients; disabling may reduce bandwidth on busy servers |
| server.lowprioritybuoyancyrange | конвар | 30 | If no players are in this range kayaks, boogie boards and inner tubes will switch to a cheaper buoyancy system |
| server.mapenabled | конвар | True | Can players use the in-game map |
| server.max_explosive_protection | конвар | 0.75 | |
| server.max_sleeping_bags | конвар | 15 | |
| server.maxclientinfosize | конвар | — | Maximum byte size of the client info blob sent during the connection handshake; clients sending a larger payload are rejected |
| server.maxconnectionsperip | конвар | — | Maximum number of simultaneous connections allowed from the same IP address; helps mitigate connection-flooding attacks (clamped 1–1000) |
| server.maxdecryptqueuebytes | конвар | — | Maximum total byte size of packets waiting for decryption; excess packets are dropped when the limit is reached |
| server.maxdecryptqueuelength | конвар | — | Maximum number of encrypted packets that can wait in the decryption queue before being dropped |
| server.maxdecryptthreadwait | конвар | — | Maximum milliseconds the decryption thread will block before timing out; increase if CPU-heavy encryption causes dropped packets (clamped 1–1000) |
| server.maxfoodspoiltimediffforitemstack | конвар | 180 | Maximum difference (in seconds) that two items with spoil timers can have and still be stackable |
| server.maximummapmarkers | конвар | 5 | How many markers each player can place |
| server.maximumpings | конвар | 5 | How many pings can be placed by each player |
| server.maxitemstacksmovedpertickindustrial | конвар | 12 | How many stacks a single conveyor can move in a single tick |
| server.maxmainthreadwait | конвар | — | Maximum milliseconds the main game thread will wait for a network operation before timing out; increase to tolerate brief network stalls (clamped 1–1000) |
| server.maxpacketsize_command | конвар | 100000 | Maximum byte size of a single console command packet from a client; oversized packets are rejected |
| server.maxpacketsize_globalentities | конвар | 1000 | Maximum byte size of a single global-entities network packet; oversized packets are dropped |
| server.maxpacketsize_globaltrees | конвар | 100 | Maximum byte size of a single global-trees network packet; oversized packets are dropped |
| server.maxpacketsize_voicedata | конвар | 8096 | Maximum number of bytes permitted in VoiceData packets, oversized packets will be dropped |
| server.maxpacketspersecond | конвар | — | Global cap on total network packets per second the server will accept across all connected clients combined |
| server.maxpacketspersecond_command | конвар | 100 | Maximum console command packets per second accepted from each client; rate-limits how quickly clients can send commands to the server |
| server.maxpacketspersecond_rpc | конвар | 200 | Maximum RPC (Remote Procedure Call) packets per second accepted from each client; limits how fast clients can trigger server-side actions |
| server.maxpacketspersecond_rpc_signal | конвар | 30 | Maximum RPC signal packets per second accepted from each client; signal RPCs are lightweight event triggers used for interactions |
| server.maxpacketspersecond_syncvar | конвар | 200 | Maximum sync-var (replicated variable) update packets per second accepted from each client |
| server.maxpacketspersecond_tick | конвар | 300 | Maximum tick-update packets per second accepted from each client; these carry player inputs and must stay within this rate to be processed |
| server.maxpacketspersecond_voice | конвар | 100 | Maximum voice chat packets per second accepted from each client; reducing this limits voice bandwidth usage per player |
| server.maxpacketspersecond_world | конвар | 1 | Maximum world-state update packets per second accepted from each individual client; prevents flooding the server with position spam |
| server.maxplayers | конвар | 500 | Maximum number of players allowed on the server at the same time |
| server.maxreadqueuebytes | конвар | — | Maximum total byte size of the incoming read queue; excess bytes are dropped to prevent memory exhaustion from a flood of large packets |
| server.maxreadqueuelength | конвар | — | Maximum number of packets that can be queued in the incoming read queue; excess packets are dropped to prevent memory exhaustion |
| server.maxreadthreadwait | конвар | — | Maximum milliseconds the dedicated read thread will block waiting for incoming data before timing out (clamped 1–1000) |
| server.maxreceivetime | конвар | — | Maximum milliseconds the network receive thread is allowed to run per frame; increase if players report missed packets on high-population servers (clamped 10–1000) |
| server.maxunack | конвар | 4 | Maximum number of unacknowledged network messages per connection before the server starts applying backpressure to that client |
| server.maxwritequeuebytes | конвар | — | Maximum total byte size of the outgoing write queue; if the queue fills the oldest packets are dropped |
| server.maxwritequeuelength | конвар | — | Maximum number of packets that can be queued in the outgoing write queue; excess packets are dropped when the queue is full |
| server.maxwritethreadwait | конвар | — | Maximum milliseconds the dedicated write thread will block waiting to send data before timing out (clamped 1–1000) |
| server.meleearmor | конвар | 1 | Global multiplier for armour effectiveness against melee damage; 1.0 = default, values above 1.0 make armour stronger against melee |
| server.meleedamage | конвар | 1 | Global multiplier for all melee weapon damage dealt; 1.0 = default, 2.0 = double damage, 0.5 = half damage |
| server.metabolismtick | конвар | 1 | Multiplier for player metabolism tick frequency; lower values slow down hunger, thirst and calorie consumption rates |
| server.modifiertickrate | конвар | 1 | Rate multiplier for status effect (buff/debuff) ticks; lower values slow all active modifiers such as poison, radiation sickness and warmth |
| server.monumentpuzzleresetradiation | конвар | True | Allows radiation to flood monuments to force puzzles to reset |
| server.monumentpuzzleresetradiationamount | конвар | 3 | Radiation damage per second applied to players inside a monument during its puzzle-reset radiation phase |
| server.monumentpuzzleresetradiationmaxradiusincrease | конвар | 20 | Clamp radiation multiplier to this amount of meters, -1 = ignored |
| server.monumentpuzzleresetradiationoverride | конвар | False | Force enable radiation in monument puzzles to confirm they work |
| server.monumentpuzzleresetradiationplayeremptytime | конвар | 120 | How long does a monument puzzle need to be empty with full rads before it can reset |
| server.monumentpuzzleresetradiationpreresettime | конвар | 300 | How long before the reset happens do we start applying radiation |
| server.monumentpuzzleresetradiationradiusmultiplier | конвар | 1.5 | Multiplier applied to a monument's normal radiation radius when the puzzle-reset radiation cloud is active; default 1.5x expands the zone beyond its usual boundary |
| server.monumentpuzzleresetwarnings | конвар | True | When enabled, chat warnings are broadcast to players inside a monument shortly before its puzzle-reset radiation begins |
| server.motd | конвар | | |
| server.netcache | конвар | True | Enables server-side network caching of entity state; when enabled only deltas are sent per update rather than the full entity data, significantly reducing bandwidth |
| server.netcachesize | конвар | 0 | Maximum byte size of the network entity cache; 0 means no hard limit |
| server.netlog | конвар | — | Enables low-level network activity logging on the server; produces verbose output useful for diagnosing connection and packet issues |
| server.netprotocol | команда | — | Returns the network protocol identifier string the server is currently using; clients must match this to connect |
| server.nonplanterdeathchancepertick | конвар | 0.005 | Probability (0–1) per growth tick that a plant growing outside a planter box will die; default 0.005 means a 0.5% chance each tick |
| server.normalisedfoodspoiltimestackthreshold | конвар | 0.9 | If two spoiled food items are both above this threshold then we will allow them to be stacked |
| server.npcammolootmultiplier | конвар | 1 | All ammo drops from NPC loot will be multiplied by this |
| server.npccorpsedespawn | конвар | 600 | Seconds before a NPC corpse is removed from the world; default is 600 seconds (10 minutes) |
| server.occlusiongatherbatchplayercount | конвар | 16 | UsePlayerUpdateJobs 4 related - how many players to gather occlusion pairs for per task |
| server.official | конвар | False | Marks this as an official Facepunch server; only set by Facepunch — do not enable on community servers |
| server.oilrig_radiation_alarm_threshold | конвар | 0 | Radiation level at which the oil rig alarm triggers; 0 means the alarm activates immediately when any radiation is present |
| server.oilrig_radiation_amount_scale | конвар | 1 | Multiplier for radiation intensity inside oil rig monuments; higher values increase radiation damage per second |
| server.oilrig_radiation_time_scale | конвар | 1 | Multiplier for how long radiation lingers after an event at oil rig monuments; higher values extend the radiation duration |
| server.optimalplanterqualitysaturation | конвар | 0.6 | Soil saturation level (0–1) at which a planter box is considered perfectly watered for quality bonuses; default 0.6 |
| server.ovencookbudgetms | конвар | 0.25 | Maximum milliseconds per frame spent processing furnace and campfire cook ticks; lower values keep frames smoother on high-population servers |
| server.packetlog | команда | — | Prints a sorted table of network packet types and their cumulative call counts since logging was enabled; requires packetlog_enabled = true |
| server.packetlog_enabled | конвар | False | Enables packet-type logging; must be true before the packetlog command will return data. Collects packet type call counts at runtime |
| server.paintballoverallsdamage | конвар | 1 | How much to scale paintball damage when both the hit player and initiator player have paintball overalls on (see paintballstandarddamage for scaling standard paintball damage) |
| server.paintballstandarddamage | конвар | 1 | How much to scale standard paintball damage (see paintballoverallsdamage for scaling damage for when players have overalls on) |
| server.parachuterepacktime | конвар | 8 | How long it takes to pick up a used parachute in seconds |
| server.parallelnetworkqueuebatchsize | конвар | 16 | UsePlayerUpdateJobs 4 related - affects how many players get batched into 1 task by counting the size of their network queues. Higher number - less tasks |
| server.pauseindustrialduringsave | конвар | True | Should industrial be paused during autosaves |
| server.pauseunlootedpuzzles | конвар | True | When enabled, the puzzle reset timer pauses for monuments that have not been looted yet, preventing resets of untouched areas |
| server.ping_region_code_override | конвар | | Override the geographic region code used for ping estimation in the server browser; leave empty to use automatic detection |
| server.pingduration | конвар | 10 | How long a ping should last |
| server.plantlightdetection | конвар | True | Enables plant light detection — growable plants will check nearby light sources each tick and adjust growth speed and quality accordingly |
| server.planttick | конвар | 60 | |
| server.planttickscale | конвар | 1 | Multiplier for plant growth tick speed; values above 1.0 make plants grow faster, values below 1.0 slow growth |
| server.player_state_cache_count | команда | — | Prints the number of player states currently held in the in-memory player state cache |
| server.player_state_cache_evictions | команда | — | Prints the total number of player state cache entries evicted since server startup; high values suggest the cache size should be increased |
| server.player_state_cache_size | конвар | — | Size of the LRU player-state cache; higher values keep more player states in memory, reducing disk reads when reconnecting players |
| server.playerlistpos | команда | — | Prints the position of all players on the server |
| server.playerserverfall | конвар | True | When true, fall damage is calculated server-side for improved anti-cheat security; disabling may reduce server load but allows clients to manipulate fall damage |
| server.playertimeout | конвар | 60 | Seconds of network inactivity before a connected player is timed out and disconnected |
| server.port | конвар | 28015 | UDP port the server listens on for player connections |
| server.premium | конвар | False | Require a premium status account to connect to this server |
| server.premiumrecheckinterval | конвар | 300 | How often to do premium status rechecks |
| server.premiumrecheckmaxbatchsize | конвар | 100 | Maximum number of players to recheck at a time |
| server.premiumrecheckminseconds | конвар | 300 | Minimum time to recheck premium status for already connected players (in seconds) |
| server.premiumverifyendpoint | конвар | https://rust-api.facepunch.com/api/premium/verify | Endpoint to use to check if players have premium status |
| server.printdecryptqueue | команда | — | |
| server.printeyes | команда | — | Print the current player eyes. |
| server.printpos | команда | — | Print the current player position. |
| server.printposcenter | команда | — | Print the current player center position. |
| server.printreadqueue | команда | — | Prints the current server incoming network read queue depth (packet count and total byte size) |
| server.printreportstoconsole | конвар | False | Should F7 reports from players be printed to console |
| server.printrot | команда | — | Print the current player rotation. |
| server.printwipeid | команда | — | Prints the current wipe id of the sav |
| server.printwritequeue | команда | — | Prints the current server outgoing network write queue depth (packet count and total byte size) |
| server.pve | конвар | False | Enables PvE mode — players cannot damage other players; they can still be killed by NPCs and the environment |
| server.pvebulletdamagemultiplier | конвар | 1 | Additional bullet damage multiplier applied only when players shoot NPCs or animals, stacks with bulletdamage |
| server.pvp_ttk_bullet | конвар | 1 | How much to increase time to kill bullets in pvp globally, 2.0 = twice as long, 0.5 = half as long |
| server.pvp_ttk_global | конвар | 1 | How much to increase time to kill in pvp globally, 2.0 = twice as long, 0.5 = half as long |
| server.pvp_ttk_melee | конвар | 1 | How much to increase time to kill with melee in pvp globally, 2.0 = twice as long, 0.5 = half as long |
| server.pvpbulletdamagemultiplier | конвар | 1 | Additional bullet damage multiplier applied only in player-vs-player combat, stacks with bulletdamage |
| server.queriespersecond | конвар | 2000 | Maximum number of Steam server browser queries the server will respond to per second before rate-limiting |
| server.queryport | конвар | 0 | UDP port used for Steam server browser queries; uses the game port if set to 0 |
| server.radiation | конвар | True | Enables radiation zones at monuments; disabling removes all radiation hazards from the map |
| server.randomize_seed | конвар | — | Setting this to true assigns a new random value to the world generation seed; useful for wipe scripts that want a fresh random map each time |
| server.readcfg | команда | — | Reads and executes serverauto.cfg then server.cfg from the server's cfg folder, applying all saved convar values |
| server.rejoin_delay | конвар | 300 | Seconds a disconnected player must wait before they are allowed to rejoin the server; default is 300 seconds (5 minutes) |
| server.reportsserverendpoint | конвар | | HTTP API endpoint for receiving F7 reports |
| server.reportsserverendpointkey | конвар | | If set, this key will be included with any reports sent via reportsServerEndpoint (for validation) |
| server.repositionattachmentsonreskin | конвар | True | Reposition attachments like storage adaptors if they have moved on reskins |
| server.resetrespawns | команда | — | Clear all static respawn points |
| server.resetserveremoji | команда | — | Rescans the serveremoji folder, note that clients will need to reconnect to get the latest emoji |
| server.respawnatdeathposition | конвар | False | If a player presses the respawn button, respawn at their death location (for trailer filming) |
| server.respawnresetrange | конвар | 50 | Radius in metres around a player's death point — any sleeping bag or bed within this range is put on a respawn cooldown to prevent spawn-camping |
| server.respawntimeadditionbag | конвар | 0 | Bags will increase their respawn time by this much |
| server.respawntimeadditionbed | конвар | 0 | Beds will increase their respawn time by this much |
| server.respawnwithloadout | конвар | False | When a player respawns give them the loadout assigned to client.RespawnLoadout (created with inventory.saveloadout) |
| server.rewounddelay | конвар | 60 | Minimum seconds that must pass after a player recovers from being wounded before they can be put into the wounded state again |
| server.rpclog | команда | — | Prints a sorted table of RPC identifiers, their string names, and cumulative call counts; requires rpclog_enabled = true |
| server.rpclog_enabled | конвар | False | Enables RPC call logging; must be true before the rpclog command will return data. Tracks how often each RPC is called |
| server.rust_relay_send_queue | конвар | — | Prints the current server decryption queue depth |
| server.salt | конвар | 1 | Secondary salt value mixed into procedural world generation; used to vary monument and road placement |
| server.save | команда | — | Force save the current game |
| server.savebackupcount | конвар | 2 | Number of rolling save-file backups to keep; each autosave rotates the oldest backup out |
| server.savecachesize | конвар | 0 | Maximum byte size of the entity save cache used to accelerate autosaves; 0 means no hard limit |
| server.saveframebudget | конвар | 5 | MS per frame to spend warming up entity save caches |
| server.saveinterval | конвар | 600 | How often (in seconds) the server automatically saves the game world to disk; default is every 600 seconds (10 minutes) |
| server.schematime | конвар | 1800 | How often (in seconds) the full entity schema is re-broadcast to all clients; default is every 1800 seconds |
| server.seed | конвар | 1337 | Seed value used for procedural world generation; changing this produces a completely different map layout |
| server.sendnetworkupdate | команда | — | Send network update for all players |
| server.server_id | конвар | — | Persistent unique identifier for this server instance, used when recording demos and for analytics attribution |
| server.setshowholstereditems | команда | — | Show holstered items on player bodies |
| server.showholstereditems | конвар | True | When enabled, weapons and tools holstered on a player's back are visible on their character model to other players |
| server.skipdeathscreenfade | конвар | False | Skip death screen fade |
| server.snapshot | команда | — | This sends a snapshot of all the entities in the client's pvs. This is mostly redundant, but we request this when the client starts recording a demo.. so they get all the information. |
| server.snapshottaskbatchcount | конвар | 64 | UsePlayerUpdateJobs 2 related - how many snapshot messages to batch into 1 task |
| server.spawnvinetrees | конвар | True | When true, vine tree variants are included during world generation; disable to remove all climbable vine trees from the map |
| server.sprinklereyeheightoffset | конвар | 3 | Vertical eye-height offset in metres used when raycasting to determine whether a sprinkler can water a given plant |
| server.sprinklerradius | конвар | 3 | |
| server.stability | конвар | True | Enables structural stability simulation; when disabled buildings will not collapse even if their supports are destroyed |
| server.start | команда | — | Starts a server |
| server.statbackup | конвар | False | Enables automatic backups of server statistics data |
| server.stats | конвар | False | Enables collection and reporting of gameplay statistics such as kill counts, damage dealt and resource gathered |
| server.stop | команда | — | Stops a server |
| server.strictauth_eac | конвар | False | When true players are kicked if EAC authentication fails; disable to allow players through even when EAC is unavailable |
| server.strictauth_steam | конвар | False | When true players are kicked if Steam authentication fails; disable to allow connections when Steam auth servers are unreachable |
| server.tags | конвар | | Comma-separated server browser tag values (see wiki) |
| server.tickrate | конвар | 10 | Number of server simulation ticks per second; higher values improve responsiveness but increase CPU usage |
| server.tutorialenabled | конвар | false | Controls whether the tutorial is enabled on this server |
| server.unlockrespawns | команда | — | Unlock all static respawn points |
| server.updatebatch | конвар | 512 | Number of entities processed per network update batch; lower values spread the load across more frames but increase total overhead |
| server.updatebatchspawn | конвар | 1024 | Number of entities processed per batch during the initial spawn network update; higher values send more entities per frame during map load |
| server.upgrade_keeps_health | конвар | True | When a deployable is upgraded in place (e.g. stacking sandbags) the new tier keeps the damaged health fraction of the one it replaced instead of spawning at full health |
| server.url | конвар | | Server website URL displayed in the server browser; leave empty to show no link |
| server.uselegacyworkbenchinteraction | конвар | False | Opens a loot panel when interacting with a workbench instead of going straight into the tech tree. Designed for backwards compatibility with mods. |
| server.useminimumplantcondition | конвар | True | When enabled, plants that would normally be in a critically poor condition are given a minimum viable condition score instead of immediately dying |
| server.useperplayerrequiredsystemconfig | конвар | False | Enables per-player required system configuration checks on connect; allows different requirements to be enforced for individual players |
| server.useplayerupdatejobs | конвар | 3 | Player Update parallelism mode: 3-4, Higher modes are faster but more experimental. 3 by default |
| server.useserverwiderequiredsystemconfig | конвар | False | Enables a server-wide required system configuration that all connecting clients must satisfy; used to enforce minimum hardware or software requirements |
| server.watercontainersleavewaterbehind | конвар | False | When transferring water, should containers keep 1 water behind. Enabling this should help performance if water IO is causing performance loss |
| server.waterwellnpcsalesrefreshfrequency | конвар | 1 | How often (in hours) the water well NPC's update their sell orders |
| server.waterwheelworkbudgetms | конвар | 0.1 | How long per frame to spend on updating water wheel power generation and water info |
| server.workbenchtaxrate1 | конвар | 0 | How much of a tax to apply to tech unlocks at a level 1 workbench. 10 = additional 10% scrap cost |
| server.workbenchtaxrate2 | конвар | 0 | How much of a tax to apply to tech unlocks at a level 2 workbench. 10 = additional 10% scrap cost |
| server.workbenchtaxrate3 | конвар | 0 | How much of a tax to apply to tech unlocks at a level 3 workbench. 10 = additional 10% scrap cost |
| server.worldsize | конвар | 4500 | Width and height of the procedurally generated world in metres; larger values create a bigger map with more resources |
| server.woundedmaxfoodandwaterbonus | конвар | 0.25 | Maximum percent chance added to base wounded/incapacitated recovery chance, based on the player's food and water level |
| server.woundedmaxoverfedchance | конвар | 1 | Wounded/incapacitated recovery chance for a player carrying a full extra bar of calories above the normal cap, scaled down by how overfed they actually are |
| server.woundedrecoverchance | конвар | 0.2 | Base chance of recovery after crawling wounded state |
| server.woundingenabled | конвар | True | Can players be wounded after receiving fatal damage |
| server.writecfg | команда | — | Writes config files |
| serverocclusion.occlusionvalidategroups | команда | — | Validates that all server occlusion network groups are correctly mapped to their occlusion data; reports any inconsistencies found |
| serverocclusion.serverocclusiondebug | команда | — | Tests occlusion visibility between two positions |
| sheep.population | конвар | 2 | Population active on the server, per square km |
| shield.infiniteshieldblock | конвар | False | |
| signage.adminscanalwaysupdatesigns | конвар | True | If true admins can always update signs, regardless of lock, build auth, etc |
| simpleshark.disable | конвар | False | |
| simpleshark.forcesurfaceamount | конвар | 0 | |
| sleepingbag.assigntoplayer | команда | — | Reassigns ownership of a sleeping bag (by entity ID) to the calling player; notifies both the old and new owner |
| sleepingbag.clearfromplayer | команда | — | Clears ownership of a sleeping bag (by entity ID), setting the owner ID to 0 and removing it from the old owner's bag list |
| sleepingbag.useteamlabels | конвар | True | |
| slotmachine.forcepayoutindex | конвар | -1 | |
| smallengine.maxthrustmultiplier | конвар | 1 | |
| snakehazard.population | конвар | 5 | Population active on the server, per square km |
| snowmobile.allowpassengeronly | конвар | False | Allow mounting as a passenger when there's no driver |
| snowmobile.allterrain | конвар | False | If true, snowmobile goes fast on all terrain types |
| snowmobile.outsidedecayminutes | конвар | 1440 | How long before a snowmobile loses all its health while outside |
| socket_free_snappable.debugsnapping | конвар | False | When enabled, draws debug visualisations for deployable snapping calculations showing candidate snap points and distances |
| socket_free_snappable.snappingmode | конвар | 2 | The current snapping mode for deployables. |
| softcore.raidwindow_allow_tc_authed | конвар | True | Allow players authed on the target base tool cupboard to use explosives outside the window (renovate, or continue a raid after capturing the TC) |
| softcore.raidwindow_allow_twig | конвар | True | Allow explosive damage to twig-grade building blocks even outside the raid window |
| softcore.raidwindow_block_extra_enabled | конвар | True | Outside the window, also block a non-explosive damage type against non-twig building blocks (e.g. shotgunning down a stone wall). Melee is only affected by softcore.raidwindow_block_melee_doors |
| softcore.raidwindow_block_extra_type | конвар | 8 | Rust.DamageType value blocked against non-twig building blocks when softcore.raidwindow_block_extra_enabled is true (default 8 = Bullet, which covers guns and shotguns) |
| softcore.raidwindow_block_melee_doors | конвар | True | Outside the window, block melee damage to doors so they can't be beaten down while the window is closed |
| softcore.raidwindow_block_mlrs | конвар | True | Block launching MLRS rockets outside the raid window so they are not wasted |
| softcore.raidwindow_enabled | конвар | true | Enable Softcore raid windows: explosive damage to building blocks is only allowed inside the configured daily time window |
| softcore.raidwindow_end_hour | конвар | 21 | Raid window end hour in server system local time, 0-24 (default 21 = 9pm). If end is less than start the window wraps past midnight |
| softcore.raidwindow_fresh_tc_seconds | конвар | 3600 | Seconds after a base's tool cupboard is placed during which the base can still be raided outside the window; 0 disables |
| softcore.raidwindow_hours_offset | конвар | 0 | Hours to widen the raid window on both sides for timezone spread (1 = opens one hour earlier and closes one hour later) |
| softcore.raidwindow_start_hour | конвар | 18 | Raid window start hour in server system local time, 0-24 (default 18 = 6pm) |
| softcore.raidwindow_status | команда | — | Print the current raid-window state: server local time, effective hours, and whether the window is open right now |
| softcore.raidwindow_weekend_enabled | конвар | false | Use separate raid hours on Saturday and Sunday |
| softcore.raidwindow_weekend_end_hour | конвар | 22 | Weekend raid window end hour, server local time (used when softcore.raidwindow_weekend_enabled is true) |
| softcore.raidwindow_weekend_start_hour | конвар | 17 | Weekend raid window start hour, server local time (used when softcore.raidwindow_weekend_enabled is true) |
| solarpanel.sunupdatebudgetms | конвар | 0.05 | |
| spawn.cargoshipdockingtest | команда | — | Spawns a cargo ship and initiates the harbor docking test sequence at the specified docking path index; used to test cargo ship docking behaviour at harbors |
| spawn.cargoshipevent | команда | — | Spawns a cargo ship and starts the cargo ship event immediately, bypassing the normal random event scheduler |
| spawn.ch47event | команда | — | Triggers a CH47 Chinook scientist event targeting the calling player position; optionally pass a start distance in metres (default 300) |
| spawn.delete_all_populations | команда | — | Deletes all entities from every active population spawner on the server at once; effectively despawns all wildlife, NPCs, and resource nodes |
| spawn.delete_populations | команда | — | Deletes all spawned entities belonging to the named population(s); pass one or more population names as arguments to target specific groups |
| spawn.dump_map | команда | — | Generates a debug spawn map for a named population, simulating up to the given number of spawn attempts and reporting how many would succeed; used to diagnose spawn point coverage |
| spawn.fill_groups | команда | — | Fills all spawn groups to their maximum count without waiting for the normal tick interval |
| spawn.fill_individuals | команда | — | Immediately respawns all individually tracked entities that are currently missing, bypassing the normal tick_individuals delay |
| spawn.fill_populations | команда | — | Immediately fills all population spawners to their target density; useful after a wipe or server restart to skip the gradual ramp-up period |
| spawn.loot_population_test | конвар | 0 | If set the loot spawn system will consider this the player count, not the actual player count. Useful for testing |
| spawn.max_density | конвар | 1 | Maximum population density scalar; controls the upper bound for how densely spawnable items fill their designated spawn areas at high player counts |
| spawn.max_rate | конвар | 1 | Maximum spawn rate scalar applied to NPC/resource population spawning; the spawn tick rate scales up to this value as player count increases |
| spawn.min_density | конвар | 0.5 | Minimum population density scalar; controls the lower bound for how densely spawnable items fill their designated spawn areas at low player counts |
| spawn.min_rate | конвар | 0.5 | Minimum spawn rate scalar applied to NPC/resource population spawning; lower values slow down respawn ticking when server population is low |
| spawn.ore_map | команда | — | Renders a PNG of every spawned ore nodes location to <rootFolder>/debug/ore-nodes.png (blue rings = safezones) |
| spawn.player_base | конвар | 100 | Base player count used when computing population spawn rates; below this value player_scale group rates are not yet applied |
| spawn.player_scale | конвар | 2 | Multiplier applied to group spawn rates based on current player count relative to player_base; higher values cause more group spawns as the server fills up |
| spawn.population_cap_rate | конвар | 300 | When scaling loot respawn rates by population, this will be considered the 'max' population, preventing loot speeding up if player counts are above this |
| spawn.report | команда | — | Prints a spawn handler report listing all populations, their current count, target count, and fill percentage; pass true for detailed mode or a name filter as a second argument |
| spawn.reset_groups | команда | — | Clears all spawn groups of already spawned entities, then re-fills them |
| spawn.respawn_groups | конвар | True | When enabled, spawn groups (monument NPCs, timed event spawners) will respawn their entities after they are cleared |
| spawn.respawn_individuals | конвар | True | When enabled, individually tracked entities (e.g. specific persistent NPCs) will respawn after a delay when destroyed |
| spawn.respawn_populations | конвар | True | When enabled, population spawners (animals, NPCs, resources) will respawn entities over time as they are killed or harvested |
| spawn.respawnloot_all | команда | — | Respawns loot in all loot containers currently on the server |
| spawn.respawnloot_lookingat | команда | — | Respawns loot in the loot container currently being looked at |
| spawn.respawnloot_radius | команда | — | Respawns loot in all loot containers within the given radius |
| spawn.scalars | команда | — | Prints a table of current spawn scalar values including player fraction, excess, population rate, density, and group rate; pass --json for machine-readable output |
| spawn.simulate_loot | команда | — | <iterations> - Simulates a number of iterations on the closest loot container and sums up the items spawned |
| spawn.svshielddummy | команда | — | Server-side handler that spawns a dummy player entity at the given position and direction loaded with the Shields loadout, optionally holstering the shield; triggered by spawn.shielddummy |
| spawn.tick_individuals | конвар | 300 | Interval in seconds between individual entity respawn ticks; controls how frequently the server checks for and respawns dead individual entities |
| spawn.tick_populations | конвар | 60 | Interval in seconds between population spawn ticks; lower values cause populations to refill faster but increase server CPU load |
| squirrel.population | конвар | 2 | Population active on the server, per square km |
| SSS.enabled | конвар | True | Enables the sub-surface scattering post-process effect on character skin, giving skin a translucent appearance under direct lighting |
| SSS.halfres | конвар | True | Renders the sub-surface scattering effect at half resolution, halving the GPU cost at the expense of slight softness in skin shading |
| SSS.quality | конвар | 0 | Sub-surface scattering quality level; deprecated and no longer used in current builds |
| SSS.scale | конвар | 1 | Controls the intensity of the sub-surface scattering effect; higher values make skin appear more translucent under direct light |
| stability.accuracy | конвар | 0.001 | Floating-point tolerance used when comparing stability values during propagation; smaller values are more precise but can cause more recalculations |
| stability.collapse | конвар | 0.05 | Stability value below which a building block is considered unsupported and will collapse; default 0.05 means blocks below 5% support fall |
| stability.log_ground_missing_death | конвар | False | When enabled, logs when entities die because their ground support entity was destroyed or is missing |
| stability.log_stability_death | конвар | False | When enabled, logs each entity death caused by a stability collapse to the server console with position and prefab name |
| stability.log_stability_updates | конвар | False | When enabled, logs every stability value change during propagation; very verbose, use only for targeted debugging |
| stability.refresh_stability | команда | — | Forces an immediate recalculation of stability for all building blocks in the world; expensive on large bases |
| stability.stabilityqueue | конвар | 9 | Maximum time in seconds that stability update jobs can run per server tick before being deferred to the next tick |
| stability.strikes | конвар | 10 | Number of stability propagation iterations performed per tick; higher values resolve complex multi-block stability chains faster at the cost of CPU time |
| stability.surroundingsqueue | конвар | 3 | Maximum time in seconds that surrounding-support check jobs can run per server tick before deferral |
| stability.verbose | конвар | 0 | Verbosity level for stability system logging; 0 = silent, higher values print more detail about stability calculations and propagation |
| stag.population | конвар | 3 | Population active on the server, per square km |
| stash.reveal_tick_rate | конвар | 0.5 | Interval in seconds between player-detection ticks for the stash container reveal mechanic; registered as stash.reveal_tick_rate |
| steam.server_allow_steam_nicknames | конвар | True | |
| storagecontainer.canrequireauthifnolock | конвар | False | When enabled, storage containers without a lock can still require tool cupboard auth to access; default false |
| storagecontainer.corpseitemssavedpercent | конвар | 0.5 | Fraction of items preserved when a storage container spawns a death corpse; 0.5 = 50% of items survive the container death |
| storagecontainer.dropcorpseondeath | конвар | — | When enabled, storage containers that die spawn a loot corpse containing their items; when false items are destroyed |
| supply.call | команда | — | Calls in a supply drop to a specific grid coordinate or position; useful for testing supply crate loot tables and airdrop pathing |
| supply.drop | команда | — | Spawns a supply drop at the calling admin or player position; the drop falls from the sky with a parachute like a naturally occurring airdrop |
| system.cpu_affinity | команда | — | Sets the CPU core affinity mask for the process using comma-separated core indices or dash-separated ranges (e.g. 0,2-5) |
| system.cpu_priority | команда | — | Sets the OS process priority class (belownormal, normal, abovenormal, high); Idle and Realtime are blocked; not supported on OSX |
| telephonemanager.maxcalllength | конвар | 120 | Maximum duration in seconds a telephone call can remain active before it is automatically terminated |
| telephonemanager.maxconcurrentcalls | конвар | 10 | Maximum number of simultaneous active telephone calls allowed on the server at any time |
| telephonemanager.printallphones | команда | — | Prints a table of all registered telephone entities showing their number, directory name, and world position |
| terrain.quality | конвар | 100 | Controls terrain rendering quality (0-100) including heightmap resolution and detail mesh density; lower values improve performance significantly on large maps |
| territory.clear | команда | — | Clear all territory ownership |
| territory.createfaction | команда | — | Create a faction, or recolour an existing one: territory.createfaction <name> <html colour, e.g. #FF0000 or #FF0000B0> |
| territory.destroy | команда | — | Remove the territory grid entirely |
| territory.factions | команда | — | List created factions and their colours |
| territory.fill | команда | — | Fill every hex cell: territory.fill <faction name|none> |
| territory.hexsize | конвар | 50 | Hex cell size in metres (centre to corner). Changing it rebuilds the grid and wipes ownership |
| territory.offsetx | конвар | — | Shifts the whole territory grid east/west in metres. Painted cells move with it |
| territory.offsetz | конвар | — | Shifts the whole territory grid north/south in metres. Painted cells move with it |
| territory.preview | конвар | False | Preview every territory grid tile on the map, owned or not. Requires the grid to exist on the server |
| territory.setat | команда | — | Set the hex cell containing a world position: territory.setat <x> <z> <faction name|none> |
| territory.setcell | команда | — | Set a hex cell by index: territory.setcell <cell> <faction name|none> |
| territory.sethere | команда | — | Set the hex cell at your position: territory.sethere <faction name|none> |
| territory.state | команда | — | Returns a JSON report of the territory grid: dimensions, offsets and a per-faction breakdown (cells held, share of claimed land, region counts) sorted by holdings |
| ticklogging.tick_uploader_lifetime | конвар | 60 | time (in seconds) before the tick uploader is disposed and recreated |
| tiger.population | конвар | 0.5 | Population active on the server, per square km |
| tigerfsm.chargerange | конвар | 20 | The range at which the tiger will charge instead of fleeing if aimed at |
| tigersneaktelegraphgrowl.minangle | конвар | 60 | Minimum angle for the tiger to growl when stalking a player |
| tigersneaktelegraphgrowl.mintimebetweengrowls | конвар | 5 | Time between growls when stalking a player |
| time.cl_maxstepsperframe | конвар | 2 | The maximum amount physics ticks per frame on clients. If things are taking too long, time slows down |
| time.cl_steps | конвар | 32 | Desired physics ticks per second on clients |
| time.missiontimerscale | конвар | 1 | Time scale which only affects mission timers |
| time.pausewhileloading | конвар | True | Pause time while loading |
| time.sv_maxstepsperframe | конвар | — | The maximum amount physics ticks per frame on the server. If things are taking too long, time slows down |
| time.sv_steps | конвар | — | Desired physics ticks per second on the server |
| time.timescale | конвар | — | The time scale |
| traincar.decayminutes | конвар | 30 | How long before a train car despawns |
| traincar.killofftracktrains | конвар | True | Should train cars that are not spawned near train tracks be killed instantly (default = true) |
| traincar.population | конвар | 2.3 | Population active on the server |
| traincar.trainturretinaccuratepervelocity | конвар | 0.1 | Chance to miss per m/s of velocity for turrets shooting players on moving trains |
| traincar.wagons_per_engine | конвар | 2 | Ratio of wagons to train engines that spawn |
| traincarunloadable.decayminutesafterunload | конвар | 10 | How long before an unloadable train car despawns afer being unloaded |
| traincouplingcontroller.max_couple_speed | конвар | 9 | Maximum difference in velocity for train cars to couple |
| translate.overrideculture | конвар | — | |
| translate.printcultureinfo | команда | — | |
| travellingvendor.alive_time_seconds | конвар | 1800 | Maximum lifetime in seconds before the Travelling Vendor despawns; default 1800s (30 minutes) |
| travellingvendor.attempt_pullovers | конвар | True | When enabled, the Travelling Vendor will attempt to stop for players and perform pullover interactions along its route |
| travellingvendor.max_speed | конвар | 5 | |
| travellingvendor.should_destroy_buildings | конвар | False | When enabled, the Travelling Vendor will destroy player-placed buildings that block its ring road path |
| travellingvendor.should_spawn | конвар | True | When enabled, the Travelling Vendor NPC is eligible to spawn on the server ring road; disable to prevent vendor spawning |
| travellingvendor.spawn | команда | — | Spawns a Travelling Vendor at the calling player's position on the nearest ring road; registered as travellingvendor.spawn |
| travellingvendor.startevent | команда | — | Spawns a Travelling Vendor event instance; registered as travellingvendor.startevent |
| tree.global_broadcast | конвар | — | When enabled, tree harvest events are broadcast to all connected clients, not just nearby players; useful for testing tree sync across the network |
| tree.simplified_collider | конвар | — | When enabled, trees use a simplified capsule collider instead of the full mesh collider, reducing physics CPU cost at the expense of collision accuracy |
| treemanager.cellsize | конвар | 100 | Define cell size(in m) of a grid for trees - only has effect on world load and must be > 1. This affects how much data we send per tree cell(bigger the cell - more trees we have to send). The smaller the cell, the more cells we have to process and the more memory we need per player to track what's left to send(gridSize ^ 2 / 8 bytes). We readjust CellSize to ensure gridSize never exceeds 512. |
| treemanager.enabletreestreaming | конвар | True | When enabled, tree data is streamed to players based on proximity rather than sending all trees at connect; reduces initial bandwidth |
| treemanager.playerbudgetms | конвар | 0.01 | Per-frame CPU budget in milliseconds allocated to sending tree streaming data per player |
| treemanager.updatebudgetms | конвар | 1 | Total per-frame CPU budget in milliseconds for the tree streaming update system |
| treemanager.uselazyserialization | конвар | True | Instead of reserializing grid cell on every tree add/removal(which can cost 0.25ms on 4.5k world), defer it to the streaming update. This reduces amount of times we need to serialize the tree list, but causes the player queue to take longer to process, as that's where evaluation happens. |
| triggerbase.clearexcludelayers | команда | — | Removes the exclude layer configuration from all registered TriggerBase instances, resetting them to detect all layers |
| triggerbase.setexcludelayers | команда | — | Applies the configured exclude layer mask to all registered TriggerBase instances to filter out unwanted layer detections |
| triggerbase.useexcludelayers | конвар | — | When enabled, triggers use an exclude layer mask to filter out specific physics layers from trigger detection; toggling clears or sets all active triggers |
| triggerboatmagnet.boatmagnetsenabled | конвар | True | When enabled, boat building station magnets are active and will magnetically attract compatible boat building blocks into position |
| triggerparent.allowtriggersleeping | конвар | True | Allow triggers to sleep if both they and their contents are stationary (TickMode 1 only) |
| triggerparent.sleeping_trigger_mask_epsilon | конвар | 0.001 | world units a trigger can move in WS before it is woken |
| triggerparent.tickmode | конвар | 1 | 0 - old InvokeHandler, 1 - Jobs |
| triggerparentdelayedexit.disable_delayed_exit | конвар | — | Makes TriggerParentDelayedExit act as a TriggerParent again |
| tugboat.tugcorpseseconds | конвар | 7200 | how long until boat corpses despawn (excluding tugboat) |
| tugboat.tugdecayminutes | конвар | 2160 | How long before a tugboat loses all its health while outside |
| tugboat.tugdecaystartdelayminutes | конвар | 1440 | How long until decay begins after the tugboat was last used |
| tutorialisland.debugislandpositions | команда | — | |
| tutorialisland.enforcetrespasschecks | конвар | True | |
| tutorialisland.overridetutoriallocation | конвар | — | Will place the tutorial as close as possible to this pos, only for debugging |
| tutorialisland.spawntutorialislandfornewplayer | конвар | True | |
| ui_dropscontroller.show_placeholder_drop_data | конвар | — | When enabled, shows placeholder/test drop data in the drops controller UI instead of live manifest data; saved between sessions |
| ui_menubackgroundvideo.emulateerror | команда | — | Triggers the video error handler on the main menu background video component, simulating a video load failure for UI testing |
| ui_menubackgroundvideo.forcenextvideo | команда | — | Forces all active main menu background video players to advance to the next video in their playlist immediately |
| ui_menubackgroundvideo.restrictmp4 | конвар | True | When enabled, MP4 video files are not used for the main menu background, falling back to WebM; use to work around MP4 codec issues |
| uiescapecapture.debug | конвар | — | When enabled, draws debug visualisations for this system (seismic sensor range sphere, escape capture state, etc.); editor/admin-only |
| unsafe.debugmtlockmaxframes | конвар | 5 | How many frames of a stack to emit |
| unsafe.enabledebugmtlock | конвар | — | Controls DebugMTLock checks, which help track down thread races. Has minor perf impact, so prefer to keep disabled |
| unsafe.usemultithreadedscripting | конвар | 1 | Controls multithreading access to scripting API - can be fast, but unsafe. Disabling can help with instability |
| vddraw.setisrecording | команда | — | Toggles or explicitly sets VDDraw recording state; when enabled starts capturing DDraw commands for replay; when disabled stops recording |
| vehicle.autohover | команда | — | Toggles auto-hover mode on the mini-helicopter the calling player is piloting, maintaining altitude automatically without pilot input |
| vehicle.boat_corpse_seconds | конвар | 300 | how long until boat corpses despawn (excluding tugboat - use tugboat_corpse_seconds) |
| vehicle.boatdriftinfo | команда | — | Print out boat drift status for all boats |
| vehicle.carwrecks | конвар | True | Determines whether modular cars turn into wrecks when destroyed, or just immediately gib. Default: true |
| vehicle.cinematictrains | конвар | False | If true, trains always explode when destroyed, and hitting a barrier always destroys the train immediately. Default: false |
| vehicle.deepseaportal_boundary_force_start_distance | конвар | 10 | Distance in metres from a deep-sea portal boundary at which the repulsion force activates for vehicles |
| vehicle.disable_wheels_when_sleeping | конвар | True | When enabled, wheel colliders are disabled on vehicles that have gone to sleep in the physics engine, reducing CPU overhead for parked vehicles |
| vehicle.fixcars | команда | — | Fixes up vehicles within 10m of the player by repairing to full hp, adding fuel to engines, and more |
| vehicle.killboats | команда | — | Destroys all boat vehicles (rowboats, RHIBs) currently spawned on the server |
| vehicle.killcars | команда | — | Destroys all modular car vehicles currently spawned on the server |
| vehicle.killdrones | команда | — | Destroys all drone vehicles currently spawned on the server |
| vehicle.killminis | команда | — | Destroys all minicopter vehicles currently spawned on the server |
| vehicle.killmotorbikes | команда | — | Destroys all motorbike vehicles currently spawned on the server |
| vehicle.killpushbikes | команда | — | Destroys all push bike vehicles currently spawned on the server |
| vehicle.killscraphelis | команда | — | Destroys all scrap transport helicopter vehicles currently spawned on the server |
| vehicle.killtrains | команда | — | Destroys all train vehicles currently spawned on the server |
| vehicle.padrepairsrequired | конвар | True | Whether repairable vehicle pads (eg. the Air Wolf helipad) have to be rebuilt with a hammer before their vendor will sell. When disabled, pads spawn already rebuilt and players cannot repair them. |
| vehicle.setrepairablepads | команда | — | Forces every repairable vehicle pad on the map to be rebuilt, or pass false to wreck them again. |
| vehicle.stop_all_trains | команда | — | Immediately stops all train entities on the server, zeroing their speed; useful for clearing deadlocked train paths |
| vehicle.swapseats | команда | — | |
| vehicle.swaptoseat | команда | — | |
| vehicle.train_accel_force | конвар | 50000 | Acceleration force used by vehicle.train_speed (default 50000, same as train engine force) |
| vehicle.train_brake_force | конвар | 50000 | Braking force used by vehicle.train_stop (default 50000, same as train engine force) |
| vehicle.train_list | команда | — | List all train engines with their entity IDs and current speeds. |
| vehicle.train_speed | команда | — | Set a train's target speed in km/h. Usage: vehicle.train_speed <km/h> (look-at) or vehicle.train_speed <id> <km/h>. Negative = reverse. |
| vehicle.train_speed_all | команда | — | Set all trains to the same target speed in km/h. Usage: vehicle.train_speed_all <km/h>. Negative = reverse. |
| vehicle.train_stop | команда | — | Gradually brake a train to a stop. Usage: vehicle.train_stop (look-at) or vehicle.train_stop <id>. |
| vehicle.trainskeeprunning | конвар | False | Determines whether trains stop automatically when there's no-one on them. Default: false |
| vehicle.vehiclesdroploot | конвар | True | Determines whether vehicles drop storage items when destroyed. Default: true |
| vehicle.world_boundary_force_offset | конвар | 25 | Additional offset applied to the world boundary force zone, extending the buffer zone inside the boundary before the force ramps up |
| vehicle.world_boundary_force_start_distance | конвар | 100 | Distance in metres from the world boundary at which a repulsion force starts pushing vehicles back inward; prevents vehicles from leaving the playable area |
| vendingmachine.clearallvendingcustomerhistory | команда | — | Wipe the backend customer stats data on all vending machines. Slow operation. |
| vendingmachine.clearallvendinghistory | команда | — | Wipe the backend stats data on all vending machines. Slow operation. |
| vendingmachine.max_history | конвар | 10000 | |
| vendingmachine.max_processed | конвар | 10000 | |
| vendingmachine.max_returned | конвар | 100 | |
| vine.draw_debug | конвар | — | |
| vine.prevent_vine_draw | конвар | — | |
| vinemountable.allowchaining | конвар | True | |
| vis.attack | конвар | — | Turns on debug display of attacks |
| vis.damage | конвар | — | Turns on debug display of damages |
| vis.hitboxes | конвар | — | Turns on debug display of hitboxes |
| vis.lerp | конвар | — | Turns on debug display of lerp |
| vis.lineofsight | конвар | — | Turns on debug display of line of sight checks |
| vis.protection | конвар | — | Turns on debug display of protection |
| vis.sense | конвар | — | Turns on debug display of senses, which are received by Ai |
| vis.triggers | конвар | — | Show trigger entries |
| vis.weakspots | конвар | — | Turns on debug display of weakspots |
| voice.loopback | конвар | False | When enabled, routes the local player microphone input back through the voice chat system so they can hear their own voice; useful for testing microphone levels |
| voice.togglevoicerangeboost | команда | — | Enabled/disables voice range boost for a player eg. ToggleVoiceRangeBoost sam 1 |
| voice.voicerangeboostamount | конвар | 50 | |
| water.quality | конвар | 1 | Controls the draw distance and density quality of decorative foliage and props; lower values improve performance by reducing the amount of decoration rendered |
| water.reflections | конвар | 1 | Controls the quality of water surface reflections (0=off, 1=simple probe, 2=full planar reflections); higher values are significantly more GPU-intensive |
| water.scaled_time | конвар | 0 | When enabled, water simulation advances in scaled (game) time rather than real time; useful for testing water behaviour during time-scale debugging |
| watercatcher.forceenableconditionalspawning | конвар | False | Debug flag to force enable conditional spawning for all water catchers, regardless of their individual settings. |
| watercatcher.oilproductionstartdelay | конвар | 900 | How long in seconds an oil pump runs after its oil switch is activated before it starts producing crude. |
| watercatcher.watercatcherbudgetms | конвар | 0.1 | |
| watertreatmentflowratebroadcast.force_flow_rate | команда | — | Force the water treatment flow rate per minute. Pass no argument to release the override and return to pressure-derived state. |
| watertreatmentflowratebroadcast.get_num_broadcasters | команда | — | |
| watertreatmentflowratebroadcast.get_num_listeners | команда | — | |
| watertreatmentwatercatcher.evaporationperminute | конвар | 200 | |
| watertreatmentwatertank.debug_wtp_pressure | команда | — | |
| watertreatmentwatertank.force_pressure | команда | — | |
| watertreatmentwatertank.maxflowrateperminute | конвар | 1020 | |
| watertreatmentwatertank.maximumpressure | конвар | 360 | |
| watertreatmentwatertank.pressuredecayperminute | конвар | 1 | |
| waypointrace.racetimeout | конвар | 900 | How long a race can go until it times out (in seconds) |
| waypointrace.startrace | команда | — | |
| weather.ambient_light_multiplier | конвар | -1 | |
| weather.arctic_fog_ambient_intensity_mult | конвар | -1 | |
| weather.arctic_fog_light_boost_mult | конвар | -1 | |
| weather.arctic_fog_ramp_end | конвар | -1 | |
| weather.arctic_fog_ramp_start | конвар | -1 | |
| weather.arid_fog_ambient_intensity_mult | конвар | -1 | |
| weather.arid_fog_light_boost_mult | конвар | -1 | |
| weather.arid_fog_ramp_end | конвар | -1 | |
| weather.arid_fog_ramp_start | конвар | -1 | |
| weather.atmosphere_brightness | конвар | -1 | |
| weather.atmosphere_contrast | конвар | -1 | |
| weather.atmosphere_directionality | конвар | -1 | |
| weather.atmosphere_fog_height_falloff | конвар | -1 | |
| weather.atmosphere_fog_ramp_end_distance | конвар | -1 | |
| weather.atmosphere_fog_ramp_start_distance | конвар | -1 | |
| weather.atmosphere_mie | конвар | -1 | |
| weather.atmosphere_rayleigh | конвар | -1 | |
| weather.biome_fog_ambient_saturation_mult | конвар | -1 | |
| weather.biome_fog_distance_curve | конвар | -1 | |
| weather.clear_chance | конвар | 1 | |
| weather.cloud_attenuation | конвар | -1 | |
| weather.cloud_brightness | конвар | -1 | |
| weather.cloud_coloring | конвар | -1 | |
| weather.cloud_config | конвар | -1 | |
| weather.cloud_coverage | конвар | -1 | |
| weather.cloud_opacity | конвар | -1 | |
| weather.cloud_saturation | конвар | -1 | |
| weather.cloud_scattering | конвар | -1 | |
| weather.cloud_sharpness | конвар | -1 | |
| weather.cloud_size | конвар | -1 | |
| weather.debug_cloud_position | команда | — | Prints the current cloud system world position and layer offsets to the console; useful for debugging cloud layer alignment on the map |
| weather.directional_light_multiplier | конвар | -1 | |
| weather.dust_chance | конвар | 0 | |
| weather.fog | конвар | -1 | |
| weather.fog_chance | конвар | 0 | |
| weather.fog_multiplier | конвар | -1 | |
| weather.jungle_fog_ambient_intensity_mult | конвар | -1 | |
| weather.jungle_fog_light_boost_mult | конвар | -1 | |
| weather.jungle_fog_ramp_end | конвар | -1 | |
| weather.jungle_fog_ramp_start | конвар | -1 | |
| weather.list_cloud_configs | команда | — | Lists all available volumetric cloud configuration asset names registered in the Climate instance |
| weather.load | команда | — | Loads and applies a named weather preset to the climate system; admin/developer only; server replicates the change to all clients |
| weather.load_cloud_config | команда | — | Loads a named volumetric cloud configuration and applies it to the climate override; admin/developer only; server replicates to clients |
| weather.moon_mesh_brightness_multiplier | конвар | -1 | |
| weather.ocean_scale | конвар | -1 | |
| weather.ocean_time | конвар | -1 | |
| weather.overcast_chance | конвар | 0 | |
| weather.rain | конвар | -1 | |
| weather.rain_chance | конвар | 0 | |
| weather.rain_grace_active | конвар | false | Whether the post-wipe rain grace period is currently active (set automatically by the server) |
| weather.rain_grace_period | конвар | 18 | Number of in-game hours after a wipe during which rain and storms are suppressed (0 to disable) |
| weather.rainbow | конвар | -1 | |
| weather.reflection_multiplier | конвар | -1 | |
| weather.report | команда | — | Prints a detailed report of the current weather state including fog, rain, wind, cloud, and all climate parameter values; admin/developer only |
| weather.reset | команда | — | Resets all weather overrides and cloud configurations, restoring the dynamic weather system; admin/developer only; server replicates to clients |
| weather.reset_cloud_config | команда | — | Clears the volumetric cloud configuration override and resets cloud settings to the dynamic weather system; server replicates to clients |
| weather.savetofile | команда | — | Saves the current environment and weather snapshot to cfg/<name>.cfg so it can later be restored with exec |
| weather.storm_chance | конвар | 0 | |
| weather.sun_mesh_brightness_multiplier | конвар | -1 | |
| weather.temperate_fog_ambient_intensity_mult | конвар | -1 | |
| weather.temperate_fog_light_boost_mult | конвар | -1 | |
| weather.temperate_fog_ramp_end | конвар | -1 | |
| weather.temperate_fog_ramp_start | конвар | -1 | |
| weather.thunder | конвар | -1 | |
| weather.tundra_fog_ambient_intensity_mult | конвар | -1 | |
| weather.tundra_fog_light_boost_mult | конвар | -1 | |
| weather.tundra_fog_ramp_end | конвар | -1 | |
| weather.tundra_fog_ramp_start | конвар | -1 | |
| weather.vclouds_moon_color_scale | конвар | -1 | |
| weather.vclouds_sun_color_scale | конвар | -1 | |
| weather.wetness_rain | конвар | 0.4 | Controls how wet surfaces become during rain; higher values cause characters and world objects to appear more soaked when it is raining |
| weather.wetness_snow | конвар | 0.2 | Controls how wet surfaces become during snow; affects surface wetness shaders independently from rain wetness |
| weather.wind | конвар | -1 | |
| wildlifehazard.chancetorepositionmultiplier | конвар | 1 | Global multiplier applied to the per-tick probability that a wildlife hazard attempts to reposition |
| wildlifehazard.clienttickrate | конвар | 0.1 | Interval in seconds between client-side tick updates for wildlife hazard entities |
| wildlifehazard.reactiontimemultiplier | конвар | 1 | Global multiplier applied to wildlife hazard reaction time; higher values make hazards slower to react to player presence |
| wildlifehazard.repositionattempts | конвар | 5 | Maximum number of position candidates sampled when a wildlife hazard searches for a valid reposition destination |
| wildlifehazard.repositionradiusmultiplier | конвар | 1 | Global multiplier for the radius used when choosing a new reposition destination for a wildlife hazard |
| wildlifehazard.repositiontimermultiplier | конвар | 1 | Global multiplier applied to the cooldown timer between wildlife hazard reposition attempts |
| wipetimer.days_to_add_test | конвар | 0 | Number of days to add to the server's wipe timer during testing; registered as wipetimer.days_to_add_test; 0 = no adjustment |
| wipetimer.hours_to_add_test | конвар | 0 | Number of hours to add to the server's wipe timer during testing; registered as wipetimer.hours_to_add_test |
| wipetimer.printtimezones | команда | — | Prints a JSON list of all system, Windows, and IANA timezone identifiers available on the server machine |
| wipetimer.printwipe | команда | — | Prints the current wipe timer status including next wipe date, frequency, and time remaining |
| wipetimer.wipecronoverride | конвар | | Custom cron expression for the wipe schedule. Overrides all other convars (except wipeUnixTimestampOverride) if set. Uses Cronos as a parser: https://github.com/HangfireIO/Cronos/ |
| wipetimer.wipedayofweek | конвар | 4 | 0=sun,1=mon,2=tues,3=wed,4=thur,5=fri,6=sat |
| wipetimer.wipehourofday | конвар | 19 | Which hour to wipe? 14.5 = 2:30pm |
| wipetimer.wipetimezone | конвар | Europe/London | The timezone to use for wipes. Defaults to the server's time zone if not set or invalid. Value should be a TZ identifier as seen here: https://en.wikipedia.org/wiki/List_of_tz_database_time_zones |
| wipetimer.wipeunixtimestampoverride | конвар | — | Unix timestamp (seconds) for the upcoming wipe. Overrides all other convars if set to a time in the future. |
| wolf2.population | конвар | 2 | Population active on the server, per square km |
| workbench.comfortradiusscale | конвар | 0.95 | Multiplier applied to the comfort trigger radius after range upgrade scaling |
| workbench.scalecomfortradius | конвар | True | Whether the range upgrade scales the comfort trigger radius |
| workbench.skipclearancechecks | конвар | False | Skip server-side upgrade clearance zone checks |
| workshop.print_approved_skins | команда | — | Prints a list of all workshop-approved skins on the server with their item short names and approved skin IDs |
| world.cache | конвар | True | When enabled, caches world data for faster loading; disabled by default in editor server builds to ensure fresh data during development |
| world.configfile | конвар | — | Path to a world generation config file used by the procedural map generator; used when configString is empty |
| world.configstring | конвар | — | World generation config string passed directly to the procedural map generator; overrides the config file if set |
| world.drawbounds | команда | — | Draws flat wireframe boxes in the world showing world bounds (red), terrain margin (yellow), deep sea bounds (cyan), and portal bounds (green/magenta) for the given duration in seconds |
| world.monuments | команда | — | Prints a table of all monuments on the current map including type, display name, prefab path, and world position; admin/developer only |
| world.renderlabs | команда | — | Renders a PNG of the current map's underwater labs, for a specific floor |
| world.rendermap | команда | — | Renders a high resolution PNG of the current map |
| world.rendertunnels | команда | — | Renders a PNG of the current map's tunnel network |
| world.streaming | конвар | True | When enabled, world assets are streamed in and out based on proximity; disable to force all world data to stay loaded at once |
| xmas.enabled | конвар | False | Enables the Christmas event on the server, activating Christmas-themed loot spawns, trees, and holiday gift mechanics |
| xmas.giftsperplayer | конвар | 2 | Target number of gift entities to maintain per connected player during the xmas event; controls overall gift density on the server |
| xmas.refill | команда | — | Manually triggers a Christmas gift spawn pass, filling the world with gifts up to the giftsPerPlayer target for all connected players |
| xmas.spawnattempts | конвар | 5 | Number of spawn attempts made per player when trying to place Christmas gifts during refill; higher values increase fill reliability in cluttered areas |
| xmas.spawnrange | конвар | 40 | Radius in metres around each player within which Christmas gift entities are spawned during the xmas event refill |
| xmasdungeon.playerdetectrange | конвар | 30 | How far we detect players from our inside/outside |
| xmasdungeon.xmaslifetime | конвар | 1200 | How long each active dungeon should last before dying |
| xmasdungeon.xmaspopulation | конвар | 0 | Population active on the server |
| ziplinelaunchpoint.highlight | команда | — | |
| ziplinelaunchpoint.report | команда | — | |
| zombie.population | конвар | — | Population active on the server, per square km |